MG_335_MONOMER – GTP-binding protein engB, putative

Name
WID MG_335_MONOMER View in model
Name GTP-binding protein engB, putative View in model
 
Genetics
Gene MG_335 View in model
 
Structure
Sequence
1
51
101
151
MDAHFLKSASDLKDCPQDNIPEICFMGRSNVGKSSLINAFFKKKLAKTSA
TPGRTQLLNYFEYKDKRFVDLPGYGFAKINKNKKDFITNLLTQFLNFRSN
LVGVVLIVDSGVVTVQDQEVVKIILQTGLNFLIVANKFDKLNQSERYFSL
KNIANFLKVNFDKCVFASTKTHHNLALVHKKIFELFVEDER*
50
100
150
192
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1581C999N262O277S5
Molecular weight (pH 7.5; Da) 21854.09 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
6335
Instability index 25.11
Is stable True
Aliphatic index 94.38
GRAVY (25C, pH 7.0) -0.137
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_392_393_21MER View in model
 
Function
Enzyme Ribosome assembly (EngB)
[c]: GTP + H2OGDP + H + PI
View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0321].
References
  1. Wicker-Planquart C, Foucher AE, Louwagie M, Britton RA, Jault JM. Interactions of an essential Bacillus subtilis GTPase, YsxC, with ribosomes. J Bacteriol 190, 681-90 (2008). WholeCell: PUB_0321, PubMed: 17981968

 
Metadata
Created 2012-10-01 15:07:58
Last updated 2012-10-01 15:14:43