MG_334_MONOMER – valyl-tRNA synthetase

Name
WID MG_334_MONOMER View in model
Name valyl-tRNA synthetase View in model
 
Genetics
Gene MG_334 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
801
MKDKFSFQKNYDFNLVSDGLYEIWNNAGFFKPKDKNNSFTAILPPPNLTG
TLHIGHAFEVSITDQIMRFKKMQGFSINWIPGFDHAGIATQTKYEKIALK
ENQKYFDADDDKKSEMIMNWALNQSEIIKNQLKSLGVCLNWSETKFTLSE
QANKIVNNCFKNLYENGFIYQAYTLVNWDTKLNTAISNIEVINKPVNQHL
HYVVYKLANDSKQELIVATTRPETIFADVCLLVNPKDKRYTNFWNKLVVN
PLTGKQIPVVTDSYVDIKFGTGILKCTPAHDFNDYEINTKYKFDFLSCID
SNGILNQNASKFQGLSVLQARNKIVKWLEKNKLLVKSIPLTSNVGFSERS
GTVVEPMLSKQWFVDLPKLKDHLYLKKYPDFIPKRFNKQVSNWLNKLKPW
CISRQLIWGHKIPVWFENNTGEIVVGEKPSKNLQNYTRSKDVLDTWFSSS
LWPLICLNWEQDDSFHETELLVTGYDILFFWVLRMLFNSFFETKKLPFKT
VLIHGLVRDEQNRKMSKSLNNGIDPVDLIRNYGADAVRLFLCSNHTPGDD
LIFSEQKIKSAWNFLNKLWNVTKFVIQLENDQEISYDLDKLSLSETWILA
KLDKVIQKITKLLDKFQLALANQILVKFVWDDFCNTFIEAIKKEPNQLKP
QLFYTAKSVLSNIAILLSITVPFLSERIYQQFNNKSVMQATWPLATKIKI
PKLFDLVLAAINDLRNYRKQYMLNSQQKLVVILSGKNAVDVKQYFNFSWI
ELKIETNKKVSFKYQIVDDTTQRLKSLQKQQAFFESEVKRSQAIVKNKSF
LEKAPKEKVKSEFLKLEEYQKKLTETNQLIAKLTKAH*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
838
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H7002C4483N1145O1247S19
Molecular weight (pH 7.5; Da) 97499.44 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
160865
Instability index 28.24
Is stable True
Aliphatic index 93.38
GRAVY (25C, pH 7.0) -0.330
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER View in model
 
Function
Enzyme valyl-tRNA (MG511) aminoacylation
[c]: ATP + VALAMP + PPI
View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0006, PUB_0095].
References
  1. Hunter S, Apweiler R, Attwood TK, Bairoch A, Bateman A, Binns D, Bork P, Das U, Daugherty L, Duquenne L, Finn RD, Gough J, Haft D, Hulo N, Kahn D, Kelly E, Laugraud A, Letunic I, Lonsdale D, Lopez R, Madera M, Maslen J, et al. InterPro: the integrative protein signature database. Nucleic Acids Res 37, D211-5 (2009). WholeCell: PUB_0095, PubMed: 18940856, URL: http://www.ebi.ac.uk/interpro/

  2. Keseler IM, Bonavides-Martínez C, Collado-Vides J, Gama-Castro S, Gunsalus RP, Johnson DA, Krummenacker M, Nolan LM, Paley S, Paulsen IT, Peralta-Gil M, Santos-Zavaleta A, Shearer AG, Karp PD. EcoCyc: a comprehensive view of Escherichia coli biology. Nucleic Acids Res 37, D464-70 (2009). WholeCell: PUB_0006, PubMed: 18974181

 
Metadata
Created 2012-10-01 15:07:58
Last updated 2012-10-01 15:14:43