MG_333_MONOMER – FMN-dependent NADH-azoreductase, putative

Name
WID MG_333_MONOMER View in model
Name FMN-dependent NADH-azoreductase, putative View in model
Cross references PDB: 2Z9D
 
Genetics
Gene MG_333 View in model
 
Structure
Sequence
1
51
101
151
MKKVIIVDASVTPSGSYTHLLLDRFLQTYKKQNSSVEFIDWNLNELPVGK
ISYNTQNASNFFSFENSDYYIDALKTAYGIVILAPMTNFNYPASLKNFID
HVFVANKTFQDKYVTKGASKGLLTNLKVVVLASQGAPLGWYPWADHVSNL
KGLFGFAGVTHFESVLIDDTKILYKDKNKQEVVDLFAHKVDQVANNF*
50
100
150
198
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1559C1027N254O292S2
Molecular weight (pH 7.5; Da) 22199.96 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
31400
Instability index 10.79
Is stable True
Aliphatic index 92.02
GRAVY (25C, pH 7.0) -0.0869
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit FMN-dependent NADH-azoreductase, putative
[c]: (2) MG_333_MONOMERMG_333_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0096]. Coenzymes Interacts with 1 FMN per monomer as coenzyme [96].
References
  1. UniProt Consortium. The Universal Protein Resource (UniProt) 2009. Nucleic Acids Res 37, D169-74 (2009). WholeCell: PUB_0096, PubMed: 18836194, URL: http://www.uniprot.org/uniprot/

 
Metadata
Created 2012-10-01 15:07:58
Last updated 2012-10-01 15:14:43