MG_332_MONOMER

Name
WID MG_332_MONOMER View in model
Cross references PDB: 1KON
 
Genetics
Gene MG_332 View in model
 
Structure
Sequence
1
51
101
151
201
MPRKHLIANQTNKKQQTSAKQLQKLAKRIASAVKKGGTNIQSNPHLKVAV
DLALAKGLSMDSIKRNIHGSEKDTTKISEFCYEIFGPNGVGIIVFGLTDN
PNRLLSSLNGYLAKLKGQLAKPNSVKINFQEEGIIFVNKNNYLKDDLIEL
LILDNINLIDVDYDEECFEISLHSNSYFHAKELLKKNNFSIVDSEIKLVP
LLTVDLDRNQQTLLSRFLNACEEDDDIQFVVHNANPWEE*
50
100
150
200
240
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1927C1203N327O365S5
Molecular weight (pH 7.5; Da) 26971.39 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
13325
Instability index 36.87
Is stable True
Aliphatic index 102.38
GRAVY (25C, pH 7.0) -0.348
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Metadata
Created 2012-10-01 15:07:58
Last updated 2012-10-01 15:14:43