MG_331_MONOMER

Name
WID MG_331_MONOMER View in model
 
Genetics
Gene MG_331 View in model
 
Structure
Sequence
1
51
101
151
201
MGRVEKFRFYRQSFDNNKIVKKALINAQKNTESWKKQLNKINQKILINYH
PFSEFNKNPVKHHTEPNKLFKTLQELIVDLKNTDFKLLEEKVDRMWLNAA
YNQTSSGYESWISDDKGIEKINHLSKFYEANEKQWLKKTSNLTSDLKEYN
KILTVFSTESFAFKKSIDNIEPNLFNANKAIFKNLVITLISFMLFSILFF
LIFLIVSFVSFV*
50
100
150
200
213
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1811C1166N293O319S3
Molecular weight (pH 7.5; Da) 25133.75 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
30940
Instability index 34.84
Is stable True
Aliphatic index 90.61
GRAVY (25C, pH 7.0) -0.354
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:07:58
Last updated 2012-10-01 15:14:43