MG_330_MONOMER – cytidylate kinase

Name
WID MG_330_MONOMER View in model
Name cytidylate kinase View in model
Cross references PDB: 2FEO
 
Genetics
Gene MG_330 View in model
 
Structure
Sequence
1
51
101
151
201
MNWQIAIDGPSSSGKSSVAKKIAEELDFFYFSSGKMYRAFAYVMQVNRLN
IDLFLKIINQINWRFEKDAVYYNNADITTVITTQSVANIASKIAVDPNIR
KIAVIKQQKLAENKNIVMDGRDIGTVVLKNAQLKFFLDAKVEIRAQRRLQ
DMGISLSNEKKLKELIQELKQRDQIDSSRTADPLKKAQDAIYLDTSELSF
DAVVKQTLKEAKKVFKL*
50
100
150
200
218
View in model
Is N‑terminal methionine cleaved
Yes
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H1812C1111N301O326S5
Molecular weight (pH 7.5; Da) 24762.35 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
19940
Instability index 32.18
Is stable True
Aliphatic index 98.90
GRAVY (25C, pH 7.0) -0.289
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0361]. Coenzymes Monomer interacts with MG with unknown stoichiometry as prosthetic group. N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

  2. Thum C, Schneider CZ, Palma MS, Santos DS, Basso LA. The Rv1712 Locus from Mycobacterium tuberculosis H37Rv codes for a functional CMP kinase that preferentially phosphorylates dCMP. J Bacteriol 191, 2884-7 (2009). WholeCell: PUB_0361, PubMed: 19181797

 
Metadata
Created 2012-10-01 15:07:58
Last updated 2012-10-01 15:14:43