MG_329_MONOMER – GTP-binding protein engA

Name
WID MG_329_MONOMER View in model
Name GTP-binding protein engA View in model
 
Genetics
Gene MG_329 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
VFTVAIIGRTNVGKSTLFNRLIQKPMAIVSDTPNTTRDRIFGIGEWLKRK
IAFIDTGGLIAKQTPLQQLIALQVQAALSQAKAIIFLVSLQEQLNSDDFY
VAKVLKKNKDKPVILVVNKAENFNPKTAEETLKDYYSLGFGRPVVISAAH
GIGIGDLMDLLVKQNQLLPNENNDDLAKIRFCVIGKPNVGKSSLINQLVK
QNRVLVSNESGTTRDAIDVPLKVNGEKFLLIDTAGIKRKGKINMGIETAS
YIKTKLAIARSNVILLMVDGSKPISEQDEVIGGLAQAALIPVIILVNKWD
LVLKNNNTTNAYKKMLKLHFKHLDFAPVLFISVLKNQRLNTIFEQLKIIQ
SQLETKVATPLLNDVIQQAQLYNQPPLFKGKRLQITYAVQTKSQIPHFVL
FCNDPKYLHFSYARFLENKIRENFGFNSVPISLYFKSKNARIRTKPEV*
50
100
150
200
250
300
350
400
449
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3745C2288N614O635S7
Molecular weight (pH 7.5; Da) 50239.25 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
26150
Instability index 21.85
Is stable True
Aliphatic index 110.94
GRAVY (25C, pH 7.0) -0.0468
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme Ribosome assembly (EngA)
[c]: GTP + H2OGDP + H + PI
View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0320].
References
  1. Xu L, Muench SP, Roujeinikova A, Sedelnikova SE, Rice DW. Cloning, purification and preliminary crystallographic analysis of the Bacillus subtilis GTPase YphC-GDP complex. Acta Crystallogr Sect F Struct Biol Cryst Commun 62, 435-7 (2006). WholeCell: PUB_0320, PubMed: 16682769

 
Metadata
Created 2012-10-01 15:07:58
Last updated 2012-10-01 15:14:42