MG_328_MONOMER – coiled coil putative structural protein involved in cytoskeleton

Name
WID MG_328_MONOMER View in model
Name coiled coil putative structural protein involved in cytoskeleton View in model
 
Genetics
Gene MG_328 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
MAVDKELEISDFDNELDEKTLLKELVQRTNNILFSPSKITAIPFERNLLE
KTFFGTVDEAEKEKSIVSFFNWMIDLKVLDKKWDKNVLNHYANQLKTREE
EQQTVDQTMAFQEVDDQSVLTKEIKTGFQELKPSVITAEDDKDEIKPEAT
KQVSFEELFNQPSEEINETKKPEVQIFSTDKVKEPEQFDDFYSIENLTKA
INPVHKTIQYDQNDDQPFVVKRILKEQHPTKKVDELDDYNNKELLLENAD
LKKQIDDLKENNNDQIFDLEQEIDDLKRRLSEEKSKHLHTKKLQDDLLQE
NRDLYEQLQNKPVAINPLSDEVNEELENLKQEKALLSDQLDALKNKSSNV
QQQLALLPVLNNQINELQNQLLTAREANQRLDLVEQENDFLKNELKKLHD
NTSNDENEKYDDLLNQYELLFDENETKFDKLQVKQQALNLDYQKTISALK
HENDVLLDEIEWTRSKDNDFNNTKNSFEEQKKALDEKLNGLTIQNQQLQD
KIAELEEWNEEKSNLNTNQLVNLQQQLKDSQNLFNVAQDKLATLEEVNLA
LNEKINDLEDELSGSENSNNLLAKLQADHEILQESYGKLKTDFEKLKKNK
LNDANEQYQDLLSAFEETNSELEKAKQSLSASDSENNQLKQQINSLENAK
KELQFTPVTSDEHLDELETLKIEKEQLFLENQALQNQLQYFNDISANQTE
EIKEASDEDKPVEIKKPRIKKRDFVIQNKDDKLAKLSKKERIQAYAERLA
KINANE*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
757
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H6122C3871N1047O1308S3
Molecular weight (pH 7.5; Da) 88352.21 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
39880
Instability index 39.41
Is stable True
Aliphatic index 86.45
GRAVY (25C, pH 7.0) -1.03
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Comments
Comments Stable modifications Phosphorylation observed by mass-spec [PUB_0094].
References
  1. Su HC, Hutchison CA 3rd, Giddings MC. Mapping phosphoproteins in Mycoplasma genitalium and Mycoplasma pneumoniae. BMC Microbiol 7, 63 (2007). WholeCell: PUB_0094, PubMed: 17605819

 
Metadata
Created 2012-10-01 15:07:58
Last updated 2012-10-01 15:14:42