MG_322_MONOMER – potassium uptake protein

Name
WID MG_322_MONOMER View in model
Name potassium uptake protein View in model
 
Genetics
Gene MG_322 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
MVKLTTWLKKIGWGETITQRIFCFYIYCILFGSLLLFLPIALQDNYQKVV
SYGIDWQGKRFEQKTDYNFLDALFLSTSAFSDTGLSTVVVSKTYSIFGQI
VLAVLLQLGGIGFVVIAFLAWRLFNFHKKEQYSFYEKLMLQSERGGSKLG
NTSEMILVSIIFLFIVELIYGFLYGILFYFIPGFEPANLFADHAKVSTQL
KALVVDSNQTIAAFNDINKAFQAGFFHSLSAVNNAGIDLIGGSSFVPYRN
GLGIIIQWLTISQIIFGGIGYPCLFDGFEAIKKKIKYGRHTKHQFSLFTK
LTVITNIVVILLFFTLLLMVEFIASDSLTNTIVNFSDEKKSLINTQLQSQ
SNQAIHASVFGNNPNASRVMQLFFMVISSRSAGFSVFPVASEIQTTKIII
ALAMFIGASPSSTAGGIRTTTLAVIFLALVAKFKGQKEVKAFKRSIDQTT
VIDAFLVLIISLIAVLLTAVLLPLSMEQPVSFIDALFETTSAFGTVGLSS
GATVNIALDPNRNTFNFLALCLLMVMGQVGVSSSVLTFVRKHPKANSYSY
PKEAVKIG*
50
100
150
200
250
300
350
400
450
500
550
559
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H4494C2878N694O773S14
Molecular weight (pH 7.5; Da) 61633.39 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
51840
Instability index 25.87
Is stable True
Aliphatic index 112.67
GRAVY (25C, pH 7.0) 0.546
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit potassium uptake protein, TrkH family, putative
(2) MG_322_MONOMER[m] + (2) MG_323_MONOMER[c] ⇒ MG_322_323_TETRAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer.
 
Metadata
Created 2012-10-01 15:07:58
Last updated 2012-10-01 15:14:42