MG_321_MONOMER – oligopeptide ABC transporter, substrate binding protein

Name
WID MG_321_MONOMER View in model
Name oligopeptide ABC transporter, substrate binding protein View in model
 
Genetics
Gene MG_321 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
801
851
901
MKLKKRYLLLGSTLTVSAALILSACASSQLNKGVFFTSSSADLLKNNSVP
LSMFNVSPTSSFFGNAYAGLTNYVATGTNRDDGVNVTDQIKEKLVLELAL
SVTGYKKTTHSGLKGRAQKNGSTDSSDGSSKNDYTKFNEWDAIGTIYRDS
SKSITEDPNYHKITQEATRYEFTINTSLSWVDNAGREVKQNNQPVKLSSK
DFERGFETYILSSNLGFNRNGYFIDLMGLDVEKTVGMDKTNGSSDGNGKG
IEITDENYDVENYRSVDDNKFNVYLTSPFPFFLSMMSKEFFFPIPHTHPK
VKALKLGKDSPLKYNQNNNRKILDQANTNFDGIYGGGVNAWKDTWSVGPY
YVESFNQAQIVFKRNQIYDAIITPNLPKTRQENEKPIPAIVSYFQPGATP
EVFYSSYIAGGLSASAVPYSQQQDARSRFNGTGDLRWLKIQKTAQSAQVT
YSGKPYVANDSTVQLNANITETEAKFLYNSESEEALTIRAGINGLINWKN
LAIIDLPNSGDVNYSTVPFGIFKEKPANGTSSGTNTDGIENDYYYKINNN
QRLGLIPEQTGTFQKDKNVLDTATVKLSYYSSTKTNGAQVRTASTSGSSS
QTSQVSSKQVSVTKQSFISALKKVGFTGNNPLHFNIKLGNASLSSNQVDY
YNALKQALTELGNDNGENLIIPEIILGDAQGPTRNEWYIGLSSVLGFSYW
SPDYDGVGTWLDAATQLNSEGIGEVITYNSGSHIVRTLLLAASQNNVFNQ
IENKLQNNTTTNGKDWCSCITSADLFKDDPYVIKNFGTNGNNGTSASLAF
TKKALSLLKFLVDNKVLKADKVKEAIKDPDKYLSKRSKIDDNKPANVSDI
HIGYELKDLYDNAAQLNRFNSIWAEQDTDNAKFLITVVDSYFPVLPVSAP
GLNETIPSLLKPWFSLRNAPSGIATMRDSGYIDE*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
850
900
935
View in model
Is N‑terminal methionine cleaved
No
View in model
Sequence sequence Type: secretory, Location: N, Length: 26 (nt) View in model
Empirical formula (pH 7.5) H7107C4585N1225O1456S10
Molecular weight (pH 7.5; Da) 103006.19 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
130445
Instability index 26.28
Is stable True
Aliphatic index 77.08
GRAVY (25C, pH 7.0) -0.480
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization e View in model
 
Function
Complex subunit oligopeptide ABC transporter
MG_077_MONOMER[m] + MG_078_MONOMER[m] + MG_079_MONOMER[c] + MG_080_MONOMER[c] + MG_321_MONOMER[e] ⇒ MG_077_078_079_080_321_PENTAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_077_078_079_080_321_PENTAMER). Complex transports oligopeptides of 2-6 amino acids, E. coli oppABCDF favors 3>4>5>2>1 amino acids, favors L>D [PUB_0424], substrate binding protein oppA homolog not present in M. genitalium or M. pneumonia; perhaps ATP-binding or transmem Signal Peptipde Signal peptide of length 24 (SPdb333564, MKLKKRYLLLGSTLTVSAALILSA) predicted by SPdb [PUB_0253].
References
  1. Choo KH, Tan TW, Ranganathan S. SPdb--a signal peptide database. BMC Bioinformatics 6, 249 (2005). WholeCell: PUB_0253, PubMed: 16221310, URL: http://proline.bic.nus.edu.sg/spdb/

  2. Guyer CA, Morgan DG, Staros JV. Binding specificity of the periplasmic oligopeptide-binding protein from Escherichia coli. J Bacteriol 168, 775-9 (1986). WholeCell: PUB_0424, PubMed: 3536860

 
Metadata
Created 2012-10-01 15:07:58
Last updated 2012-10-01 15:14:42