MG_319_MONOMER

Name
WID MG_319_MONOMER View in model
 
Genetics
Gene MG_319 View in model
 
Structure
Sequence
1
51
101
151
MRLFRFLFKLCFLLLVLVGFAYLFLAIFYFGSLNPFELAQPMDVFNRFFS
KEALDNISSNNGATATAQTSSLLQLLEGSSNGLDNRFPTEKSAFYAIPGY
VDFLKNAKLPGFVEQFTPYLTKYVIPLGMAFVSGLIGTLIVNFFLNKITR
SIKRRKRNMKKQEQEEYYDDSRSRRKRN*
50
100
150
179
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1476C953N244O254S5
Molecular weight (pH 7.5; Da) 20575.66 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
12045
Instability index 49.48
Is stable False
Aliphatic index 88.83
GRAVY (25C, pH 7.0) -0.0430
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:07:57
Last updated 2012-10-01 15:14:42