MG_318_MONOMER – P32 adhesin

Name
WID MG_318_MONOMER View in model
Name P32 adhesin View in model
 
Genetics
Gene MG_318 View in model
 
Structure
Sequence
1
51
101
151
201
251
MELNGFLRYKKLFIVLALLFTTILIVSLSLLAFALVVKTNGSELGVVFHQ
TEDNTTVIQGRSIVEQPWFIPTVAGSFGFSALAIILGLAIGLPIVKRKEK
RLLEEKERQEQIAEQLQRISDQQEQQTVEIDPQQSQAQPSQPQVQQPLQP
QFQQRVPLLRPAFNPNMQQRPGFNQPNQQFQPHNNFNPRMNPNMQRPGFN
PNMQQRPGFNQPNQQFQPHNNFNPRMNPNMQRPGFNQPHPNQFAQPNNFN
PNMQQRPGFNPNMQQRPNPSQLMPKGGLKP*
50
100
150
200
250
281
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2243C1433N421O405S10
Molecular weight (pH 7.5; Da) 32169.28 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
6990
Instability index 47.55
Is stable False
Aliphatic index 68.68
GRAVY (25C, pH 7.0) -0.744
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization tm View in model
 
Function
Enzyme P65 terminal organelle assembly
View in model
 
Comments
Comments signal peptide length 36 [PUB_0303]
References
  1. Theiss P, Karpas A, Wise KS. Antigenic topology of the P29 surface lipoprotein of Mycoplasma fermentans: differential display of epitopes results in high-frequency phase variation. Infect Immun 64, 1800-9 (1996). WholeCell: PUB_0303, PubMed: 8613394

 
Metadata
Created 2012-10-01 15:07:57
Last updated 2012-10-01 15:14:42