MG_317_MONOMER – high molecular weight cytadherence accessory protein 3

Name
WID MG_317_MONOMER View in model
Name high molecular weight cytadherence accessory protein 3 View in model
 
Genetics
Gene MG_317 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
MNDKQKAKINKAYNKLLKKINKRYPDVSVVYARDHKNKVHALYQDPESGN
IFSLEKRKQLASNYPLFELTSDNPISFTNNIVSLNAYDDKNNLVTVQYDQ
DNNTFYDQNGNVLDVSSYTDEKKVPLINYLSSTQTSQEQPTQQDYPSIDA
GLPKIEVDDQPKAAQHTTLETESEPDVFELNDSLNQPQQPTENLGDDQFV
EKEVPPTQQLHQDLVHQQPVQVDSGSQNHSFNNSPSLKPPLVNKPAKLVQ
PEVKHIPQVEVQPKPQIVEPKIEPKPEVKHVSHVEIQPKPEVKPVVDSVP
EVKQPEVKHVPHVEVQPKPVVDLKPQRIEPRIESKPEVIKHIPQVEVQPK
AQMVEPRIEPKPETKYIPQVESTPQVEVHHWKPEVKTEYQPQQPLPTSGL
QIKVVPRSAALLQSKLDTGFQPRQVERTTDSDITVSVSSHASLLEKINAL
NHQRIMSDIALKSDNTIKSSNFSRFYPENEYVATKYSDPLYSDTNQSLTS
DRFSLDFDYTPKSRVNNYTPLRSTNFQNNAISNYRFSRTPSSYYPLTRRP
WRLTNISSYRSSFHSPTRLSSFRRTSLPFSSSYDGLRRYPSRSYWSKDF*
50
100
150
200
250
300
350
400
450
500
550
600
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H4777C3056N846O954S3
Molecular weight (pH 7.5; Da) 68728.73 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
55240
Instability index 55.88
Is stable False
Aliphatic index 71.68
GRAVY (25C, pH 7.0) -0.900
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization tc View in model
 
Function
Enzyme P32 terminal organelle assembly
View in model
 
Comments
Comments Pich et al showed that MG_317 knockouts have reduced gliding motility, and that MG_317 is involved in terminal organelle formation and tethering the terminal organelle to the cell membrane [PUB_0803]. Stable modifications Phosphorylation observed by mass-spec [PUB_0094].
References
  1. Pich OQ, Burgos R, Ferrer-Navarro M, Querol E, Piñol J. Role of Mycoplasma genitalium MG218 and MG317 cytoskeletal proteins in terminal organelle organization, gliding motility and cytadherence. Microbiology 154, 3188-98 (2008). WholeCell: PUB_0803, PubMed: 18832324

  2. Su HC, Hutchison CA 3rd, Giddings MC. Mapping phosphoproteins in Mycoplasma genitalium and Mycoplasma pneumoniae. BMC Microbiol 7, 63 (2007). WholeCell: PUB_0094, PubMed: 17605819

 
Metadata
Created 2012-10-01 15:07:57
Last updated 2012-10-01 15:14:42