MG_316_MONOMER – DNA internalization-related competence protein ComEC/Rec2

Name
WID MG_316_MONOMER View in model
Name DNA internalization-related competence protein ComEC/Rec2 View in model
 
Genetics
Gene MG_316 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MQTKLFYFFVLLSFIPGFFLVQQEQFVALSIWIILITLFSLWYDWKFCLL
NLTIVGFFIAFCYFVPAVKINQIVKNNFIRTPFINWIDQTTKGELNQYLK
LFLINETTKNNLYQNALKLNIVHLFVISGFHLSFLFNLMERFLWKRWYLN
KLSGFAVLLIYLFLVGFAFSALRVFISTLLKQVFKKQLPEDNLSLTALLI
ILISNHALNNFGFNFSFLACFVLLFVNKLKLLKALKPLVSSSLILIVISP
LSLYLNSRLNAFSVLFNLLFSPIALFYFCVSWIILPFIGVFGQASFGIYL
PLKMLSEWSLKVTVFLQIPKPNLIFFFVYYGLLGLLYTIFTVAYYDNNLW
SRYWANSPKIKSNQKQFSI*
50
100
150
200
250
300
350
370
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3202C2118N467O487S7
Molecular weight (pH 7.5; Da) 43223.25 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
79340
Instability index 28.01
Is stable True
Aliphatic index 130.65
GRAVY (25C, pH 7.0) 0.806
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit DNA internalization-related competence protein ComEC/Rec2
[m]: (2) MG_316_MONOMERMG_316_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer [PUB_0179].
References
  1. Kramer N, Hahn J, Dubnau D. Multiple interactions among the competence proteins of Bacillus subtilis. Mol Microbiol 65, 454-64 (2007). WholeCell: PUB_0179, PubMed: 17630974

 
Metadata
Created 2012-10-01 15:07:57
Last updated 2012-10-01 15:14:42