MG_315_MONOMER – DNA polymerase III, delta subunit, putative

Name
WID MG_315_MONOMER View in model
Name DNA polymerase III, delta subunit, putative View in model
Cross references PDB: 1XXI
 
Genetics
Gene MG_315 View in model
 
Structure
Sequence
1
51
101
151
201
251
MTIIYGQDIGLIHQKLSQIKSNSPYKTIWFKDLKQLYDLFSQPLFGSNNE
KFIVNNCSFLEKTSLTRQENLCLEKLKTTDVVLTVYTDNPFSGIKTIKSI
TTVFCDKLDWKSMHKAIGEVCRELNLKLDLEIIDWLANALPLNMGVIYQE
INKLSLLGKNEIKDNKLVETVICDYQPVQIYKLTKALTNSQIVKAFKYID
ELASTKPNFATQFLEFFSGELLLALMVKSCNPKQLTNINLNVNQFRLIAI
QSQYHNFTSKVLVNIINAIQKLDIKLKHNDGFAIPLLKNFALSFFTN*
50
100
150
200
250
298
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2487C1561N390O440S10
Molecular weight (pH 7.5; Da) 34078.35 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
30660
Instability index 24.05
Is stable True
Aliphatic index 108.93
GRAVY (25C, pH 7.0) -0.0262
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit DNA-directed DNA polymerase gamma complex
[c]: MG_007_MONOMER + MG_315_MONOMER + (4) MG_419_MONOMERDNA_POLYMERASE_GAMMA_COMPLEX
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see DNA_POLYMERASE_GAMMA_COMPLEX) [PUB_0312, PUB_0313, PUB_0314].
References
  1. Bruck I, O'Donnell M. The DNA replication machine of a gram-positive organism. J Biol Chem 275, 28971-83 (2000). WholeCell: PUB_0314, PubMed: 10878011

  2. Kelman Z, O'Donnell M. DNA polymerase III holoenzyme: structure and function of a chromosomal replicating machine. Annu Rev Biochem 64, 171-200 (1995). WholeCell: PUB_0312, PubMed: 7574479

  3. Razin S, Yogev D, Naot Y. Molecular biology and pathogenicity of mycoplasmas. Microbiol Mol Biol Rev 62, 1094-156 (1998). WholeCell: PUB_0313, PubMed: 9841667

 
Metadata
Created 2012-10-01 15:07:57
Last updated 2012-10-01 15:14:41