MG_314_MONOMER

Name
WID MG_314_MONOMER View in model
 
Genetics
Gene MG_314 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
MTFSEILTKVQNNLDIVFNNETLRTRIKTDSDFAKTILAQLKLLYFLEEK
QKRVKTKKPDHFLFGSFHDKFIQLGQNQLSEKELKAAKFDLTDALDLANY
LNVAVKNLFNKELNSFTKLAETQVKPVSELQENNKTVKDNPSFQTINNSQ
QLNSGLENNILQQTLQVRARDRAFGRFTSEKLVGKIFEFQFKSQWIKWAQ
LAIFISMIAIFFISIAYVVMVNVFFTHFVDKNSPLFNVNNDQNTVQQSNA
DTTNLNRFFALSSSNLITMIFLAFGGASFFFAFQGKPYSFATRGQTNRAM
RYLRSEFGVKEFPKINDNYRYKVRIKWIFWTIFIFVFLNCIPGNIVRSGF
WNAALIIRLFSENQLISVSPLFASYLIGIAWLFVFSIVPFSIISVIAFSL
SPKLNLEQTNEIFNKYFQEELAKPITSDESKTTLDIPPPTIFG*
50
100
150
200
250
300
350
400
444
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3653C2372N599O650S6
Molecular weight (pH 7.5; Da) 51153.25 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
46535
Instability index 27.60
Is stable True
Aliphatic index 93.56
GRAVY (25C, pH 7.0) -0.0320
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:07:57
Last updated 2012-10-01 15:14:41