MG_312_MONOMER – high molecular weight cytadherence accessory protein 1

Name
WID MG_312_MONOMER View in model
Name high molecular weight cytadherence accessory protein 1 View in model
 
Genetics
Gene MG_312 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
801
851
901
951
1001
1051
1101
MAKNKQSVFEEKNYTQTEPENIFGDLYDGKSTVEEDPNIKVAYDADGNGY
YIAFNKETGVYYDPYGDTEYDISQLFDENGNPFVFDEKQEENDYLKYVGN
PDYGSYDENGEWVWSGYFENDQWISTKESQPTDENYGFDSDLPPEVKQPE
SVEDNYGFDNDLPPEVKQPESVEDNYGFDNDLPPEVKQPESVVDQPSSDD
YFAKQPTDENYGFDNDLPPEVKQPESVVDQPSSDDHFAKQPESTTDSYSF
DSDLPQPTLDQPSLDDHVQYNFDHHEELKPVAEEQNNYQVGFDQVQANLD
NNEEIQPTAEKKVTTDFESKQAQVVDSYQLPIDTDQQDQTTFSSSFETQP
TVEQFDQVNSEVNDQFKPEITKEPVLESSFNKQDVVETSDLNSESNLYSE
NNKDATNNDSLNSEFIQLNSNSETASDDVHYESKSEPIHDYKFGSDLSQS
NSNNSLESEPVKFNSETAPDAHFESQSEPVDQVQYDIYQNEELKPTLDQP
SSDDYFAKQPTDENYGFDNDLPPEVKQPESVVDQPSSDDHFAKQPESTTD
SYSFDSDLPQPTLDQPSLDDHVQYNFDHHEELKPVAEEQNNYQVGFDQVQ
ANLDNNEEIQPTAEKEVTTDFESKQAQVVDSYQLPIDTDQQDQTTFSSSF
ETQPTVEQFDQVNSEVNDQFKPEITKEPVLESSFNKQDVVETSNYTNNLQ
KFDIQSDNKITITTKKSSPQIPTTLPISFVSNRIEYKPVETLALDNKESQ
QEQITINSITEDSKTLAKTLSVQLQQINSLNNQSIVTSESVRLDKKDDQL
TINTVNSEDQQPKIEVFVKAKEPVEEHSITQNKQSVEDKSELDNFNKKSD
LYKIISELKRGELNPTINFDAIFQMNDYQMSVKQSFIHLNDFVTNYKNQI
SERYLIIKKELQSELSRLIDQNENLNVQFNNAKNLTTLQKEEMIRSLASD
FAIAYKPSNSYEQLQKSGEIMRHVQRAITENEKKIESIQGSLKQLKTVYN
SCCETIMNNINKLDNTLRFAKKEKDPLLLSNFDSVTDNGLVEPNQLMDDL
IDFSNTFDNISNEQLDDFIYENMDRNIDFEFEGFNNDFVDIDAKVMDSMS
AFSVNDLDIETLVPDRTSNFSSLLDEDLFESSGDFSLDY*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
850
900
950
1000
1050
1100
1140
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H8457C5699N1467O2030S12
Molecular weight (pH 7.5; Da) 130384.18 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
83800
Instability index 53.32
Is stable False
Aliphatic index 62.61
GRAVY (25C, pH 7.0) -0.996
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization tc View in model
 
Function
Enzyme View in model
 
Comments
Comments Burgos et al showed that MG_312 N-terminal domain is involved in gliding motility and C-terminal domain is involved in cytadherence and terminal organelle assembly [PUB_0811].
References
  1. Burgos R, Pich OQ, Querol E, Piñol J. Functional analysis of the Mycoplasma genitalium MG312 protein reveals a specific requirement of the MG312 N-terminal domain for gliding motility. J Bacteriol 189, 7014-23 (2007). WholeCell: PUB_0811, PubMed: 17675381

 
Metadata
Created 2012-10-01 15:07:57
Last updated 2012-10-01 15:14:41