MG_311_MONOMER – ribosomal protein S4

Name
WID MG_311_MONOMER View in model
Name ribosomal protein S4 View in model
Cross references PDB: 1P87, PDB: 2Z4M
 
Genetics
Gene MG_311 View in model
 
Structure
Sequence
1
51
101
151
201
MKYTGSIFKRSRRLGFSLLENNKEFSKGKKRKSIPGQHGNRFRSSTLSGY
AQQLQEKQRMQYMYGITDKQFRRLFRFVLKQKGNLTVNLFRVLESRLDNI
VYRMGFAPTRKSARQMVNHGHVILNDQTVDTPSIIINPGDKVRLKARITK
SPLVKNFIENSVISSFVETNKKAFEGTYIRFPERSELPAGINESYVVEWY
KRLVK*
50
100
150
200
206
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1747C1075N315O296S5
Molecular weight (pH 7.5; Da) 23980.56 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
17420
Instability index 44.93
Is stable False
Aliphatic index 77.52
GRAVY (25C, pH 7.0) -0.619
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit 30S ribosomal subunit
[c]: MGrrnA16S + MG_070_MONOMER + MG_087_MONOMER + MG_088_MONOMER + MG_090_MONOMER + MG_092_MONOMER + MG_150_MONOMER + MG_155_MONOMER + MG_157_MONOMER + MG_160_MONOMER + MG_164_MONOMER + MG_165_MONOMER + MG_168_MONOMER + MG_175_MONOMER + MG_176_MONOMER + MG_311_MONOMER + MG_417_MONOMER + MG_424_MONOMER + MG_446_MONOMER + MG_481_MONOMER + MG_522_MONOMERRIBOSOME_30S
View in model
 
Comments
Comments Functional Macromolecule Functional as part of 30S ribosomal particle.
 
Metadata
Created 2012-10-01 15:07:57
Last updated 2012-10-01 15:14:41