MG_310_MONOMER – hydrolase, Putative esterase/lipase 1

Name
WID MG_310_MONOMER View in model
Name hydrolase, Putative esterase/lipase 1 View in model
 
Genetics
Gene MG_310 View in model
 
Structure
Sequence
1
51
101
151
201
251
MRLEIENGLEFVNDPVVNELGKICFFHPFTGNLTNKLSFRSHFNRYSFYA
INYPGHGNSVINNPKQLEFSYWLEITKQFFDKHNLKDVILFGHSIGGGLA
VALTNYLSSDQYKAVLLEAPLNPAIVETPLNIVQNLIPDPDSDFAVIQKC
LVYNIEKKLGANFKEYCEREKQKSIHQNQRLKVMLEPSTLKQNIVLINAA
FLKLNCPALWIHGKQDGIIKYLPSKAYYESLNNKQIQFKAIEAAAHTPYF
EQPQKFLSLVNDFFQLIS*
50
100
150
200
250
269
View in model
Is N‑terminal methionine cleaved
No
View in model
Sequence sequence Type: secretory, Location: N, Length: 64 (nt) View in model
Empirical formula (pH 7.5) H2176C1418N362O392S6
Molecular weight (pH 7.5; Da) 30758.94 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
29380
Instability index 34.94
Is stable True
Aliphatic index 96.43
GRAVY (25C, pH 7.0) -0.195
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization e View in model
 
Function
Enzyme View in model
 
Comments
Comments Lipases observed to funcation extracellularly in bacteria [PUB_0451, PUB_0452]. However weak computational evidence for extracellular localization and secretory signal sequence (PrediSI [PUB_0255], SOSUI [PUB_0261, PUB_0264], Phobius [PUB_0262], SignalP-NN [PUB_0263], SignalP-HMM [PUB_0263]).
References
  1. Bendtsen JD, Nielsen H, von Heijne G, Brunak S. Improved prediction of signal peptides: SignalP 3.0. J Mol Biol 340, 783-95 (2004). WholeCell: PUB_0263, PubMed: 15223320, URL: http://www.cbs.dtu.dk/services/SignalP/

  2. Gomi M, Sonoyama M, Mitaku S. High performance system for signal peptide prediction: SOSUIsignal. Chem-Bio Info J 4, 142-7 (2004). WholeCell: PUB_0264, URL: http://www.jstage.jst.go.jp/article/cbij/4/4/4_142/_article

  3. Hirokawa T, Boon-Chieng S, Mitaku S. SOSUI: classification and secondary structure prediction system for membrane proteins. Bioinformatics 14, 378-9 (1998). WholeCell: PUB_0261, PubMed: 9632836, URL: http://bp.nuap.nagoya-u.ac.jp/sosui/sosuiG/sosuigsubmit.html

  4. Jaeger KE, Ransac S, Dijkstra BW, Colson C, van Heuvel M, Misset O. Bacterial lipases. FEMS Microbiol Rev 15, 29-63 (1994). WholeCell: PUB_0451, PubMed: 7946464

  5. Käll L, Krogh A, Sonnhammer EL. A combined transmembrane topology and signal peptide prediction method. J Mol Biol 338, 1027-36 (2004). WholeCell: PUB_0262, PubMed: 15111065, URL: http://phobius.sbc.su.se/

  6. ... 2 more

  7. Nielsen H, Engelbrecht J, Brunak S, von Heijne G. Identification of prokaryotic and eukaryotic signal peptides and prediction of their cleavage sites. Protein Eng 10, 1-6 (1997). WholeCell: PUB_0255, PubMed: 9051728, URL: http://www.predisi.de/

  8. RotteM S, Razin S. Lipase Activity of Mycoplasma. J Gen Microbiol 37, 123-34 (1964). WholeCell: PUB_0452, PubMed: 14215435

 
Metadata
Created 2012-10-01 15:07:57
Last updated 2012-10-01 15:14:41