MG_309_MONOMER – lipoprotein, putative

Name
WID MG_309_MONOMER View in model
Name lipoprotein, putative View in model
 
Genetics
Gene MG_309 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
801
851
901
951
1001
1051
1101
1151
1201
MKRFLHRVKWPLLLSSIAVSLGIVAVACAQPNSRTIENLFRPSSAFTDKN
DGSINATLYKALENREGLTQYLTMRLAPVLRNFYEENVDDDIKRNLRTFN
TDTDNSFVNQEQNLRNQYRGDYLVRLQTDILDNTGGNQANWKLRDVNNKI
VDDFINKLFTKNFVEYVDKSVGVLSTPLKGLIENQSNWNNIKIQAKFVDK
NKRLRINNDAVYAAIQDKLLDQFVTNENPNLVSRVVFTNETPNDGFDNYF
NPDLIKSPTPSYQFQVFNKYNQQDNSIKGANGFHILASNLQSYVNTNNKT
IDIPNKFSSDSGGKLLLKASDMFDTFDPSFSAAFIQGYLALQKKSKGAEQ
TEYTKLEKDKSIIENFFVENNSAKAAMKSASSSSQTTTVHKTDLAKIFKE
NETTKSTDVFKGEYQKKFSNATSTSNSDSSNNSAIVDLKELKKDNNSQPD
LILARGKDGIHLMGVDGGGYYLSESGRDVNKQKQFLLFRALQTKYGLIDT
NTTYDFKLFDEVKKHFDKNRVLFLFNALFKLVDSKESNFLSFPQFKKFSD
SIITVKNELKDLVESQYQQIVFNEVATAENKVALKLAERNQPFIDNERNK
QIWMNGLAAVLPYEQDSKTGHYNELGIYYKDIIDKVSSNTSNSNSNSNSS
SSDPFSKKIIDKLKENKKKVEAAVKKHVDELKVSVIPSPQYSQIILVDTK
LSSDPRNTSLALNLALNAVLSSDELQNTIRRDYFVNDDQFKQAIDLDKLT
FKNWNSLNNENWNIFKYTYLFDLFQKQANPSIFGNGVNESSTDNKPKING
VLDSLYNSLNLEERLDSNDLINYYSYLYTVQWLLKDNLKNLKQNLQAKLS
RTTNSFLVWSLASDKDRNNTASQAMSVSSSKSVLVKMANNVASQTNQDFT
KQEQQNPNYVFGSSAYNWTNNKTPTVNSAANDISSLYYTKNNGSSSTSLT
LMQKSAQQTNNQQRRFGFHGIVTNTSSNNLPDAVRNRLFTSFVSQSEKSS
SNGGQAQLQSTQSSGSNETIYKGALFSFGSLTKLIETIDNIPTQAEFDAL
YNHLTSNLNINVTGVDRSKSLQEQKTNLKNFANSNFNNTQTVQLKQAQSK
TNNSNFNDVFSRFEGYIGTNKTSNYSSYNFLQDNQIYHAVYAKQINLEDV
SMLGSDSLNSTDSNNSKRLDLSLEEFLSTVALEALNPNNQTQAINALIAN
AKNGLVRVGDNRLFSAISSQWVRKF*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
850
900
950
1000
1050
1100
1150
1200
1226
View in model
Is N‑terminal methionine cleaved
No
View in model
Sequence sequence Type: lipoprotein, Location: N, Length: 27 (nt) View in model
Empirical formula (pH 7.5) H9585C6114N1691O1954S11
Molecular weight (pH 7.5; Da) 138395.01 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
119195
Instability index 30.90
Is stable True
Aliphatic index 77.94
GRAVY (25C, pH 7.0) -0.630
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Comments
Comments Signal Peptipde Signal peptide of length 27 (SPdb333261, MKRFLHRVKWPLLLSSIAVSLGIVAVA) predicted by SPdb [PUB_0253].
References
  1. Choo KH, Tan TW, Ranganathan S. SPdb--a signal peptide database. BMC Bioinformatics 6, 249 (2005). WholeCell: PUB_0253, PubMed: 16221310, URL: http://proline.bic.nus.edu.sg/spdb/

 
Metadata
Created 2012-10-01 15:07:57
Last updated 2012-10-01 15:14:41