MG_308_MONOMER – ATP-dependent RNA helicase

Name
WID MG_308_MONOMER View in model
Name ATP-dependent RNA helicase View in model
 
Genetics
Gene MG_308 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
MQFSSSIRQFLDKKRIVEFTKIQQAVFKLWPFQNIIGIAETGSGKTFAYL
LPLLDKINTSLDQPQAVIFVPTKELQWQIINILTEIKKYFKTFTFATSFS
SKAQLIVSLLNEKYLFTSKVRYVVFDEIDMFLEQSSIQQWLECVHLFQKA
KPLFAFFSATLFNQQLQIIKKQVINTKVINLHPKQWIHPLVKHFVVHLNT
ENRFSGLLALLKHHQNQQIIVFCSNQKSLKQLTQLLSNNNISFGSIYGSL
TYQERKNNFTKATNNKLKLLVVSDLFSRGIDLNYFSVVISWDLPKIDSFY
IHRSGRVARLNSWGRSYLFWNDQNQSKLNKLIAKGIKFQNVSLTSNGDLK
FLTENNQKTTKKPLSTLQIKKIKAIKAKYKKVKPNYKKYQKQQIQNLLIN
KKKPRSWKNF*
50
100
150
200
250
300
350
400
411
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3548C2227N584O588S4
Molecular weight (pH 7.5; Da) 48039.68 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
62130
Instability index 28.79
Is stable True
Aliphatic index 97.93
GRAVY (25C, pH 7.0) -0.277
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_392_393_21MER View in model
 
Metadata
Created 2012-10-01 15:07:57
Last updated 2012-10-01 15:14:41