MG_306_MONOMER – membrane protein, putative

Name
WID MG_306_MONOMER View in model
Name membrane protein, putative View in model
 
Genetics
Gene MG_306 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MAKLTTNTFFNTKNIVAFSFFLVFLIVISVIVTIFFLGVSVDDVKTIITA
INYQNWGWIFVVILGFLVSVLWNVIINWWVSRRFCFYASWWEWLLFGFVV
QFFQIVTPLSLGQDPFRLYWFIKKGMKKQTAVLIVTSTGAFWNLSQALIT
WPSFFVLSKNYQLLANNHNSFVSYWLSLTGMIFDVVVAILFIVIAFNKKM
HVLIYSLVNQFRKWLKRPYLTKEQIYQRFIEKAEFNKLYGIEMRRWGLTI
FKLLANMVVAIVSYFSLFGVFMITKTVNTTNNVIDQYSLIDLFNITNIAV
TASNFIPVASGEGATQFVMTSFLNAFKPTDQFLHDQIKDGVFLWRLLSVY
LPAIFTGICFVVWIVQVIWEFKKTVNVPLKTVNTVSLETKKDK*
50
100
150
200
250
300
350
394
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3334C2201N508O534S10
Molecular weight (pH 7.5; Da) 45775.62 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
111630
Instability index 21.97
Is stable True
Aliphatic index 114.90
GRAVY (25C, pH 7.0) 0.621
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:07:57
Last updated 2012-10-01 15:14:41