MG_305_MONOMER – chaperone

Name
WID MG_305_MONOMER View in model
Name chaperone View in model
Cross references PDB: 2BPR
 
Genetics
Gene MG_305 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
MSADNGLIIGIDLGTTNSCVSVMEGGRPVVLENPEGKRTTPSIVSYKNNE
IIVGDAAKRQMVTNPNTIVSIKRLMGTSNKVKVQNADGTTKELSPEQVSA
QILSYLKDFAEKKIGKKISRAVITVPAYFNDAERNATKTAGKIAGLNVER
IINEPTAAALAYGIDKASREMKVLVYDLGGGTFDVSLLDIAEGTFEVLAT
AGDNRLGGDDWDNKIIEYISAYIAKEHQGLNLSKDKMAMQRLKEAAERAK
IELSAQLETIISLPFLTVTQKGPVNVELKLTRAKFEELTKPLLERTRNPI
SDVIKEAKIKPEEINEILLVGGSTRMPAVQKLVESMVPGKKPNRSINPDE
VVAIGAAIQGGVLRGDVKDVLLLDVTPLTLSIETLGGVATPLIKRNTTIP
VSKSQIFSTAQDNQESVDVVVCQGERPMSRDNKSLGRFNLGGIQPAPKGK
PQIEITFSLDANGILNVKAKDLTTQKENSITISDNGNLSEEEIQKMIRDA
EANKERDNIIRERIELRNEGEGIVNTIKEILASPDAKNFPKEEKEKLEKL
TGNIDAAIKANDYAKLKVEIENFKKWREEMAKKYNPTGEQGPQAK*
50
100
150
200
250
300
350
400
450
500
550
596
View in model
Is N‑terminal methionine cleaved
Yes
View in model
Empirical formula (pH 7.5) H4726C2853N796O902S14
Molecular weight (pH 7.5; Da) 65059.56 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
24660
Instability index 34.11
Is stable True
Aliphatic index 94.75
GRAVY (25C, pH 7.0) -0.389
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_392_393_21MER View in model
 
Function
Protein folding substrates MG_004_MONOMER, MG_005_MONOMER, MG_021_MONOMER, MG_023_MONOMER, MG_026_MONOMER, ... 33 more View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0014]. Stable modifications Phosphorylation observed by mass-spec [PUB_0094]. N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280].
References
  1. Eds Lund P. Molecular Chaperones in the Cell. Oxford University Press, New York (2001). WholeCell: PUB_0014, ISBN: 9780199638673

  2. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

  3. Su HC, Hutchison CA 3rd, Giddings MC. Mapping phosphoproteins in Mycoplasma genitalium and Mycoplasma pneumoniae. BMC Microbiol 7, 63 (2007). WholeCell: PUB_0094, PubMed: 17605819

 
Metadata
Created 2012-10-01 15:07:57
Last updated 2012-10-01 15:14:41