MG_303_MONOMER – metal ion (cobalt) ABC transporter, ATP-binding protein, putative

Name
WID MG_303_MONOMER View in model
Name metal ion (cobalt) ABC transporter, ATP-binding protein, putative View in model
 
Genetics
Gene MG_303 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MQTPQIKLDLIEQKYHLQAQKANLKLAKLDSKKLFSFYKKVDKIINPFYF
LNSKKSIPFFNSKLLNIEQDPLFFNNISVFVNKHNDGQIIKCCSGVIEPN
KITVIFGESGSGKTTLIKQLGLFEKPSFGYINCANYCYFANQYQQKITKN
FKQKIGYILQKAEDQFFCDSILEEVLTGAVNLKLCHKKDVNYAKKYLDLC
GLENIPLIKNPIELSDGQKKRLALASVLAMQVKFLILDEPTVGLDQMAIS
NLSKMLVAMKQTTRIVIVSHDVDFIFETADKIIHLHQGKIIHQTTVNDFF
SNTSWLMQYGITPPVIIQAVKMFNEKGIAFKNQAEIKNLDDLISELKNLF
SCKKPVF*
50
100
150
200
250
300
350
358
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2977C1871N470O517S15
Molecular weight (pH 7.5; Da) 40808.35 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
22890
Instability index 32.41
Is stable True
Aliphatic index 100.75
GRAVY (25C, pH 7.0) -0.0911
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit metal ion (cobalt) ABC transporter
(2) MG_302_MONOMER[m] + MG_303_MONOMER[c] + MG_304_MONOMER[c] ⇒ MG_302_303_304_TETRAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_302_303_304_TETRAMER).
 
Metadata
Created 2012-10-01 15:07:57
Last updated 2012-10-01 15:14:41