MG_302_MONOMER – metal ion (cobalt) ABC transporter, permease protein, putative

Name
WID MG_302_MONOMER View in model
Name metal ion (cobalt) ABC transporter, permease protein, putative View in model
 
Genetics
Gene MG_302 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MQKTSFLNKIDPLLKLWFWLISLVVAFLPLGLYGLVIINLVFLTLVVISE
KRVKSALIILSWMLFFLWFNVIVNGFIFLPNTALSVDQNHNFLGSFIYSG
GNNFGGVSWWSFNLRSFLRSFVIALRISMLFSASFLLTTSSSIYELAWAV
ERFFKFLKLFHIKVQPISILLAVIFKLLPTVKSEIIRIKQAQATRGFIYN
KCSFLNPFKIKTLFIPVLLSTVKKTETTAFALQAKGYDLNNTNRTHYPLK
YNLLNGVFLLVGLLLFSILLIANNWNLVYWENPNYSFNFDKQNFIFLRAI
NSNNLLYFWQIELIAIG*
50
100
150
200
250
300
318
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2715C1769N414O424S4
Molecular weight (pH 7.5; Da) 36694.16 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
70025
Instability index 25.98
Is stable True
Aliphatic index 127.20
GRAVY (25C, pH 7.0) 0.642
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit metal ion (cobalt) ABC transporter
(2) MG_302_MONOMER[m] + MG_303_MONOMER[c] + MG_304_MONOMER[c] ⇒ MG_302_303_304_TETRAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_302_303_304_TETRAMER).
 
Metadata
Created 2012-10-01 15:07:57
Last updated 2012-10-01 15:14:41