MG_300_MONOMER – phosphoglycerate kinase

Name
WID MG_300_MONOMER View in model
Name phosphoglycerate kinase View in model
Cross references PDB: 1ZMR
 
Genetics
Gene MG_300 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
MLNFKTLQAIDFQNKTVVLRSDFNVPMINGVISDSERILAGLDTIKFLVK
KNCKIVLLSHLSRIKSLEDKLNNKKSLKPVAELLQQLLPTVKVQFSCKNT
GAEVKQKVQALAFGEILLLENTRYCDVNDKGEIVKLESKNDPELAKFWAS
LGEIFVNDAFGTAHRKHASNAGIAKYVAKSCIGFLMEKELKNLSYLIQSP
QKPFVVVLGGAKVSDKLKVVENLLKLADNILIGGGMVNTFLKAKGKATAN
SLVEKELIDVAKQILDKDTHNKIVLAIDQVMGSEFKDQTGITLDVSDKIQ
EQYQSYMSLDVGSKTIALFESYLKTAKTIFWNGPLGVFEFTNFAKGTSKI
GEIIAKNKTAFSVIGGGDSAAAVKQMQLSDQFSFISTGGGASLALIGGEE
LVGISDIQKNS*
50
100
150
200
250
300
350
400
412
View in model
Is N‑terminal methionine cleaved
Yes
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H3291C2021N525O598S11
Molecular weight (pH 7.5; Da) 44864.50 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
20440
Instability index 24.24
Is stable True
Aliphatic index 103.88
GRAVY (25C, pH 7.0) -0.00121
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER, MG_392_393_21MER View in model
 
Function
Enzyme View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0359, PUB_0360]. Coenzymes Interacts with 1 MG per monomer as prosthetic group [387]. N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280].
References
  1. Bourniquel AA, Mollet B. Purification and characterization of the 3-phosphoglycerate kinase from the thermophile Lactobacillus delbrueckii subsp. Lactis. Int Dairy J 12, 723-8 (2002). WholeCell: PUB_0360, URL: http://www.sciencedirect.com/science/article/pii/S0958694602000699?_rdoc=3&_fmt=high&_origin=browse&_srch=hubEid(1-s2.0-S0958694600X00702)&_docanchor=&_ct=11&_refLink=Y&_zone=rslt_list_item&md5=dbd816d3191ded1ead9faeb0eb3ed686

  2. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

  3. Mizuno Y, Ohshima M, Yao Y, Shibasaki R, Takahashi R, Tokuyama T. Purification and comparison of phosphoglycerate kinases from nitrifying bacteria. J Ferm Bioeng 86, 346-50 (1998). WholeCell: PUB_0359, URL: http://www.sciencedirect.com/science/article/pii/S0922338X99890023?_alid=1836135768&_rdoc=1&_fmt=high&_origin=search&_docanchor=&_ct=1&_zone=rslt_list_item&md5=ad64f242d082461e4b7cdca993115afc

 
Metadata
Created 2012-10-01 15:07:57
Last updated 2012-10-01 15:14:40