MG_299_MONOMER – phosphate acetyltransferase

Name
WID MG_299_MONOMER View in model
Name phosphate acetyltransferase View in model
 
Genetics
Gene MG_299 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MSVIDIFKKRLQAVSKKPVIIFPEGWSASVLKAVEMLNESKLIQPAVIFH
NRQEIPANFDKKITHYVIDEMDLTSYANFVYEKRKHKGMDLKEAQKFVRD
PSSLAATLVALKVVDGEVCGKEYATKDTLRPALQLLATGNFVSSVFIMEK
GEERLYFTDCAFAVYPNSQELATIAENTFNFAKSLNEDEIKMAFLSYSTL
GSGKGEMVDKVVLATKLFLEKHPELHQSVCGELQFDAAFVEKVRLQKAPQ
LTWKNSANIYVFPNLDAGNIAYKIAQRLGGYDAIGPIVLGLSSPVNDLSR
GASVSDIFNVGIITAAQAIK*
50
100
150
200
250
300
321
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2542C1609N414O467S10
Molecular weight (pH 7.5; Da) 35478.44 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
26275
Instability index 34.56
Is stable True
Aliphatic index 96.32
GRAVY (25C, pH 7.0) -0.0202
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER View in model
 
Function
Complex subunit phosphate acetyltransferase
[c]: (2) MG_299_MONOMERMG_299_DIMER
View in model
 
Comments
Comments First observed residue by mass-spec 3 [PUB_0280]. Functional Macromolecule Functional as homodimer.
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

 
Metadata
Created 2012-10-01 15:07:57
Last updated 2012-10-01 15:14:40