MG_297_MONOMER – signal recognition particle receptor

Name
WID MG_297_MONOMER View in model
Name signal recognition particle receptor View in model
Cross references PDB: 2QY9
 
Genetics
Gene MG_297 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MGFLSKLIAKLKPKKSVAKQLKEEVEKQSLFQTNNKTYYQGLKKSATTFA
KTINELSKRYVNVDEQFKENLFEGLVLLDVGYHAANKICDAIIEQIKLNR
ITDFQLIKELIIDQIIVYYIQDKLFDTDLIVKPNFTNVYLFVGVNGVGKT
TTLAKIADFFIKQNKRVLLVAGDTFRAGAIEQLNQWAKLLNCDIVLPNPK
EQTPAVIFRGVKKGIDDKYDFVLCDTSGRLQNKLNLMNELQKIYQIIQKV
SGSEPSETLLVLDGTVGQTGLSQAKVFNEFSKLTGIVLTKMDGSAKGGII
LAIKDMFNLPVKLIGFGEKTSDLAIFDLEKYVLGLLNNLNLDNKEN*
50
100
150
200
250
300
347
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2867C1772N450O511S7
Molecular weight (pH 7.5; Da) 38875.77 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
20775
Instability index 20.70
Is stable True
Aliphatic index 109.25
GRAVY (25C, pH 7.0) -0.0712
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Parameters
Parameters Parameter_0107: SRP_GTPUsedPerMonomer = 2 GTP/monomer View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0003].
References
  1. Eds Dalbey RE, von Heijne G. Protein Targeting, Transport, and Translocation. Academic Press, San Diego (2002). WholeCell: PUB_0003, ISBN: 9780122007316

 
Metadata
Created 2012-10-01 15:07:57
Last updated 2012-10-01 15:14:40