MG_296_MONOMER

Name
WID MG_296_MONOMER View in model
 
Genetics
Gene MG_296 View in model
 
Structure
Sequence
1
51
101
MKPQLIAFKKFLQTEFQAVDFETFRINFNLCLKREQDNIVIYEDDDYDDQ
PFFFKPMLSDGFFIQTEVIKQLDYLAKVVENPKDSDQQCCQNFYEALIVF
ISALAITKGINPNRFHQRLVNRFAIHAVY*
50
100
130
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1058C706N176O197S5
Molecular weight (pH 7.5; Da) 15323.30 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
7825
Instability index 26.57
Is stable True
Aliphatic index 87.00
GRAVY (25C, pH 7.0) -0.194
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Comments
Comments Shin crystallized M. pneumoniae MPN493, a homolog of MG_296 [PUB_0800].
References
  1. Sluijter M, Spuesens EB, Hartwig NG, van Rossum AM, Vink C. The Mycoplasma pneumoniae MPN490 and Mycoplasma genitalium MG339 genes encode reca homologs that promote homologous DNA strand exchange. Infect Immun 77, 4905-11 (2009). WholeCell: PUB_0800, PubMed: 19737894

 
Metadata
Created 2012-10-01 15:07:56
Last updated 2012-10-01 15:14:40