MG_295_MONOMER – tRNA U34 sulfurtransferase

Name
WID MG_295_MONOMER View in model
Name tRNA U34 sulfurtransferase View in model
Cross references PDB: 2DEU
 
Genetics
Gene MG_295 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MSIIAKTVFIGLSGGVDSAVSALLLKKQYQEVIGVFMECWDETLNNDFYG
HKKINNNKSGCSSFQDFQQAKKIANSLGIKLIKKNLIEAYWNKVFLPMIQ
SFKKGLTPNPDIWCNRFIKFGLLHDFCKQINPNSLFATGHYAKINMIENQ
PLLSIPKDTNKDQTYFLANVKKEQFQNVIFPLADLKKITVRNIARENNWE
VADKKDSTGICFIGERHFSDFLKNYLPVKKGLIKDWKTKQTISEHDGVWF
YTIGQRSGLNLGGLKQRHFVVAKDIETNELFVSCDKEELLKTTILLDQFN
WLYTPKQLPSQVLVRIRHAQKPEIAKLKLLSDNKLEITFKNPVISVASGQ
FGVLYTLDQICLGAGLI*
50
100
150
200
250
300
350
368
View in model
Is N‑terminal methionine cleaved
No
View in model
Disulfide_bonds MG_295_MONOMER_ox: 114-211 View in model
Empirical formula (pH 7.5) H3029C1918N499O530S11
Molecular weight (pH 7.5; Da) 41911.19 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
52785
Instability index 32.28
Is stable True
Aliphatic index 96.68
GRAVY (25C, pH 7.0) -0.205
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Enzyme View in model
Complex subunit oxidized tRNA U34 sulfurtransferase
[c]: MG_295_MONOMER ⇒ (2) H + MG_295_MONOMER_ox
View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0046].
References
  1. Eds Schomburg D, Schomburg I, Chang A. Class 2 Transferases I: EC 2.1.1. Springer Berlin, Heidelberg (2006). WholeCell: PUB_0046, ISBN: 9783540319177

 
Metadata
Created 2012-10-01 15:07:56
Last updated 2012-10-01 15:14:40