MG_294_MONOMER – major facilitator superfamily (MFS) protein

Name
WID MG_294_MONOMER View in model
Name major facilitator superfamily (MFS) protein View in model
 
Genetics
Gene MG_294 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
VIVTTKKGFKKRLKDFSKQQILALIILGAIDVFVIAAPYYVKNVVPNLHL
YLGITEDEVATVTSIIGYVTLATQLPGGFLTNRFSSRKLLFLSAITTGAI
TFWLAANILTKNQQSHDALFIQYCVIWGLWGITSTLIFWTPLWKLASQQA
TKENQALGFGIQGAANGIWGLIFIFLIALIITSIFYPSGGSENADSKPFA
AYAFIIAIMLVITGFTVLFFVKEKPIEKQSQTTLVSFKRNLNQILVTLKN
WKLWLLSFFLMGMYVFQSTFAYYLLQMLQNAFLAPVVLVTVIGGIRTYAL
RSAVSVYLCRLADKCKSYILFLMICTVLGIVFVLAFILLGFVQTNSANIT
LITFSSILYIFTGILSWGMVTVRYNQIGEIDIGKNNYASSVGLLSFIGFS
TDGWLYTVTAEVGKKYTVAGQSNTSNTGYQIIAAICLSIALFGLICGSIV
FISNSMEIKRLNKASYRWRDLDNA*
50
100
150
200
250
300
350
400
450
475
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3872C2476N589O646S13
Molecular weight (pH 7.5; Da) 52643.49 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
91050
Instability index 31.57
Is stable True
Aliphatic index 120.72
GRAVY (25C, pH 7.0) 0.663
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0095, PUB_0316].
References
  1. Hunter S, Apweiler R, Attwood TK, Bairoch A, Bateman A, Binns D, Bork P, Das U, Daugherty L, Duquenne L, Finn RD, Gough J, Haft D, Hulo N, Kahn D, Kelly E, Laugraud A, Letunic I, Lonsdale D, Lopez R, Madera M, Maslen J, et al. InterPro: the integrative protein signature database. Nucleic Acids Res 37, D211-5 (2009). WholeCell: PUB_0095, PubMed: 18940856, URL: http://www.ebi.ac.uk/interpro/

  2. Law CJ, Maloney PC, Wang DN. Ins and outs of major facilitator superfamily antiporters. Annu Rev Microbiol 62, 289-305 (2008). WholeCell: PUB_0316, PubMed: 18537473

 
Metadata
Created 2012-10-01 15:07:56
Last updated 2012-10-01 15:14:40