MG_293_MONOMER – glycerophosphoryl diester phosphodiesterase

Name
WID MG_293_MONOMER View in model
Name glycerophosphoryl diester phosphodiesterase View in model
Cross references PDB: 1T8Q, PDB: 1YDY
 
Genetics
Gene MG_293 View in model
 
Structure
Sequence
1
51
101
151
201
MHNKQLLLAHRGYSFIAPENTKLAFDLAFEYCFDGIELDVHLTKDEQLVI
IHDETTLRTALVNKEVEFESLVSLKRDDHSAFFHLKIQFQSILTLKEFLD
LYLDKFKLINIEIKTDQKPYLGIEKKLVDLVKGYGKKAIDKILFSSFNFE
SLQKVYDLDNSYKKGFLFWTKKQFETISTARIQKICQFLHPWTKIYEKYP
QMIKKLNLPLNLWTVNSQNKFQQFLADNHVYAQIANKKFEIKIN*
50
100
150
200
245
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H2088C1348N333O365S4
Molecular weight (pH 7.5; Da) 28927.19 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
31650
Instability index 30.08
Is stable True
Aliphatic index 99.10
GRAVY (25C, pH 7.0) -0.282
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit glycerophosphoryl diester phosphodiesterase family protein
[c]: (2) MG_293_MONOMERMG_293_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer. Not clear from BLAST which of MG_293 and MG_385 best maps onto ugpQ and glpQ. Consequently, unclear which enzyme is likely a homodimer and which is likely a monomer. Coenzymes Monomer interacts with MG, CO, MG, or CA with unknown stoichiometry as prosthetic group.
 
Metadata
Created 2012-10-01 15:07:56
Last updated 2012-10-01 15:14:40