MG_292_MONOMER – alanyl-tRNA synthetase

Name
WID MG_292_MONOMER View in model
Name alanyl-tRNA synthetase View in model
 
Genetics
Gene MG_292 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
801
851
901
MNWTTDKVRQTWLDYFAKKDHLVLASKSLIPINDPSLLWINSGVATLKDY
FSARKTPPSKRLVNAQICLRVNDIENVGFTSRHQTLFEMLGNFSIGDYFK
TEAIDFAFDLLVNYYQLDPKRFYITVYEDDETTYKRWIKHKIDKNHIIKC
DKSRNFWDLGLGPCGPCTEIYYDRGEKFDPKKIGEKLFFEDIENDRYVEI
WNIVFSQFNNDGNGNYTELAQKNIDTGAGIERLVSVLQNSPTNFDTDIFL
KLIKIIEAFCPFKYDPNSYFTFDPQKVKEQSYFRIIADHFKAITFTISEG
VLPGPNERNYVVRRLLRRALIACKKLQLNLAFIEKIIDEIIASYENYYQH
LKAKNETVKQVVLKEINAFNKTIDLGLVLFEKSVKNNTLTPQLTFQLNET
YGFPVEIIRELVNQKGLTIDWTVFDQLMAKHRSISKQNNQTINFEKQNIN
LVNFKTKSTFFYHKNKINAKVIGLFDENYLPVKELNNQSGYVVFDQTVLY
ATSGGQRYDEGSCINHSNNNDQKISFQGVFKGPNKQHFHYFLVGSFKLND
QVTLSHDETWRKLAANNHSLEHLLHAALQKEIDPLIKQSGAFKSAQKATI
DFNLNRHLTRNELEKVENKIRSLIKQKISSKEIFTDFEGSQKLNAIAYFE
EEYSQHEILRVIRFGDYSVELCGGTHVANTASIEDCFITDFYSLGAGRWR
IEIISSNETINNYLKAENQKLIQLKSELEKVLSLIDSSIFKVELKELQQR
LDKFILPEKITQLRDASDTLLALKNDINQLKTKNYKVSQQALALSIKKQL
LSLVDENKSYVIATFNDVEPKLLLQTLHDVFNQNQTKNFLIINQFNESNS
FIVIGNKTTTIIEKLRNSFNLKGGGNDKLFRGSFQDNVTPQKLNELFQNK
*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
850
900
901
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H7378C4732N1253O1382S12
Molecular weight (pH 7.5; Da) 104317.26 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
99795
Instability index 35.63
Is stable True
Aliphatic index 91.42
GRAVY (25C, pH 7.0) -0.430
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER View in model
 
Function
Complex subunit alanyl-tRNA synthetase
[c]: (4) MG_292_MONOMERMG_292_TETRAMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homotetramer. Coenzymes Monomer interacts with ZN with unknown stoichiometry as prosthetic group.
 
Metadata
Created 2012-10-01 15:07:56
Last updated 2012-10-01 15:14:40