MG_291_MONOMER – phosphonate ABC transporter, permease protein (P69), putative

Name
WID MG_291_MONOMER View in model
Name phosphonate ABC transporter, permease protein (P69), putative View in model
 
Genetics
Gene MG_291 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
MITKLFFHQVGDNKKRLIWYWKLLIIIAVLAIVIYSWIDNFSSFNQFGLN
VFINNITSLFTPNLNHEYTLVRFLAQTAFFVTGGSFLGFIFAILFSYWTA
FKIQPFYIALPIRLITIVLRAFPVLLFGFLFSNLFNKQLAATLTISWFSF
LWNTKYITTFFENSNLKYFFNKKIREGSGFKAFWTTIFLSENERLWLFFL
YSLEANFRWTTLLSIFGIGGIGQLIVDPLSIRVQFDLVLIPLVVLITFLI
FIEVVVFLLSSFVFEKNSEDLRPILKTTVIEKRKWKRIIFILFIVVLISL
SLANLVTIDYRINDAEFLQDFFNQFFQLKSNLFSSNDPNINPILMLVKLT
TQAISLISLVVIFSILFGFISCNLFKKRFSISFKILLLFVRVVPSILLFR
LLDPLFLEAKTTIILVLLINHGSSYGQLMSINFNKANQNIINNYKNHGMT
KGFILWNYLLVENKPNLINITSDAYDSVIRDLILFGSFGGSIIGSRITNF
FERAQFDNLGSVTIPLMVYLIAIEIIFLSVRLTRISVFKNYLY*
50
100
150
200
250
300
350
400
450
500
544
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H4663C3037N703O743S6
Molecular weight (pH 7.5; Da) 63102.99 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
84465
Instability index 28.65
Is stable True
Aliphatic index 129.34
GRAVY (25C, pH 7.0) 0.701
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit phosphonate ABC transporter
MG_289_MONOMER[e] + (2) MG_290_MONOMER[c] + (2) MG_291_MONOMER[m] ⇒ MG_289_290_291_PENTAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_289_290_291_PENTAMER).
 
Metadata
Created 2012-10-01 15:07:56
Last updated 2012-10-01 15:14:40