MG_290_MONOMER – phosphonate ABC transporter, ATP-binding protein, putative

Name
WID MG_290_MONOMER View in model
Name phosphonate ABC transporter, ATP-binding protein, putative View in model
 
Genetics
Gene MG_290 View in model
 
Structure
Sequence
1
51
101
151
201
MENKPILSFEKVSIIYKKAPLLQNISFKVMAKENVCLLGKSGVGKSSLLN
SVTNTKIVKSGLVYFDGVASNKKEYKKLKKQCSYLDQIPNLIDTDYVYEA
ILRSAKQKLTWLQKLICFEPKWIKDKILAILKEVNLNDYVSCIIKDLSAG
QKQRVEIAKLFFKSPKLLLVDEPTTGLDPLTASKIMDLITDFVKREKITL
VFVTHDIDLALKYSTRIIALKNHALVLDRLTEKLTKEQLYKIYDN*
50
100
150
200
246
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2119C1286N321O358S7
Molecular weight (pH 7.5; Da) 28029.89 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
26400
Instability index 22.21
Is stable True
Aliphatic index 115.28
GRAVY (25C, pH 7.0) -0.0728
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit phosphonate ABC transporter
MG_289_MONOMER[e] + (2) MG_290_MONOMER[c] + (2) MG_291_MONOMER[m] ⇒ MG_289_290_291_PENTAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_289_290_291_PENTAMER).
 
Metadata
Created 2012-10-01 15:07:56
Last updated 2012-10-01 15:14:40