MG_289_MONOMER – phosphonate ABC transporter, substrate binding protein (P37), putative

Name
WID MG_289_MONOMER View in model
Name phosphonate ABC transporter, substrate binding protein (P37), putative View in model
 
Genetics
Gene MG_289 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
VLFKKFTWVIPSLFLTIISTSLLISCATKSDNTLIFNISLDHNADTSIEK
FFTVFSKKLSGKLNKKINVNFNIVDDSFTKINNIQANKADFAFVNSQAIA
SNNWFGYTPLIQTLTTAFKEDLELDYYEDGNLQKKAEKTNLLFLSPPYKE
WDDIKQKWTGNRYDFLYEPSKLVSFYRSMILITGSASEITAIKKAWNEKN
WNQFMKFGIGHGQTNSASRFELPDLLFRKHFAKNYPGLQNAINSDPDKFA
VVRGREIGINKNIKIVFDDANSFSWTQNIKGSKRPFYTPIDPNDRLEILT
YSDPLLYDIGIVSNNLSRIYQKAIGEIFIELAQSSEDLYGPSIGYNGYKM
INDFEKEVVEIIEKTYGK*
50
100
150
200
250
300
350
369
View in model
Is N‑terminal methionine cleaved
No
View in model
Sequence sequence Type: secretory, Location: N, Length: 27 (nt) View in model
Empirical formula (pH 7.5) H2970C1940N486O563S4
Molecular weight (pH 7.5; Da) 42237.40 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
62465
Instability index 30.95
Is stable True
Aliphatic index 87.24
GRAVY (25C, pH 7.0) -0.328
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization e View in model
 
Function
Complex subunit phosphonate ABC transporter
MG_289_MONOMER[e] + (2) MG_290_MONOMER[c] + (2) MG_291_MONOMER[m] ⇒ MG_289_290_291_PENTAMER[m]
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_289_290_291_PENTAMER). Signal Peptipde Signal peptide of length 25 (SPdb181518, MLFKKFTWVIPSLFLTIISTSLLIS) predicted by SPdb [PUB_0253].
References
  1. Choo KH, Tan TW, Ranganathan S. SPdb--a signal peptide database. BMC Bioinformatics 6, 249 (2005). WholeCell: PUB_0253, PubMed: 16221310, URL: http://proline.bic.nus.edu.sg/spdb/

 
Metadata
Created 2012-10-01 15:07:56
Last updated 2012-10-01 15:14:40