MG_288_MONOMER – protein L

Name
WID MG_288_MONOMER View in model
Name protein L View in model
 
Genetics
Gene MG_288 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
MDFEVDYEGGNNTVNLQFDLKAQTSNFLNLQELQNSFNGNDLNTQLFWKP
LINKLVDKNQNDLTSIAKTAVSDSLFLSNTNIFNSVLKIDEQLDLAKTKF
EKEIIEPFKKEREKAKADYEEQQRILAEERRKQEEELKRKEEEAKRLKEQ
QEQFNKSFENAKEFKDYWKNQKKDVTDKTQLIDALKTSFAADKNKTFSLL
INSFTKATSDYYKNNKKDESENAKKAFSEKGIQFPRQGLEGLYMSDWLRG
KLTSYTDIKLNLTSIKIENKENNPTIDWKNNGIEFRQHYPYKFKFEIDIK
YQGGYKLTGLFSWFAPFSGIPSSWNGEMDVKFIVDGDLDYNLVQNTDYPG
SLFQFKDNQLLFTLHVKEQIKVQDGKFMDLLKQQNLHNLDLRNGATKPPV
VDLASYLHYLVLNS*
50
100
150
200
250
300
350
400
415
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3375C2185N572O666S4
Molecular weight (pH 7.5; Da) 48440.73 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
55350
Instability index 33.94
Is stable True
Aliphatic index 75.20
GRAVY (25C, pH 7.0) -0.830
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Metadata
Created 2012-10-01 15:07:56
Last updated 2012-10-01 15:14:40