MG_287_MONOMER – acyl carrier protein

Name
WID MG_287_MONOMER View in model
Name acyl carrier protein View in model
Cross references PDB: 2FHS
 
Genetics
Gene MG_287 View in model
 
Structure
Sequence
1
51
MQTHEILLKIKEIAKSKNFNLNLDEKTINQPLRELKIDSLDMFSIVVSLE
NEFGISFDDEKLMNLKNLADLVLEVKNLLAKKGV*
50
85
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H716C434N110O130S3
Molecular weight (pH 7.5; Da) 9651.15 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
0
Instability index 9.94
Is stable True
Aliphatic index 121.53
GRAVY (25C, pH 7.0) -0.125
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Reaction participant acyl-carrier protein synthase
[c]: COA + MG_287_MONOMERH + MG_287_MONOMER_ACP + PAP
View in model
Complex subunit View in model
 
Metadata
Created 2012-10-01 15:07:56
Last updated 2012-10-01 15:14:40