MG_286_MONOMER

Name
WID MG_286_MONOMER View in model
 
Genetics
Gene MG_286 View in model
 
Structure
Sequence
1
51
101
151
MIFSISKRKLICGFLLVILTIGGVLGGVYLVTKNNKDNYQNESNFNNQEQ
ISKIPNFKAIGPETQRILRERNYPLDDSGYYVYKYGEINRYLRNESELDE
LINYRVMVPSLKLHHKRVNFDKAFLESKLRKWIIKAIKQHNYFQHFENEP
NLRVQYNMNIPAQKIDVNAVWSYKKDNDAATGKPIRYWDQFELKLK*
50
100
150
197
View in model
Is N‑terminal methionine cleaved
No
View in model
Sequence sequence Type: secretory, Location: N, Length: 30 (nt) View in model
Empirical formula (pH 7.5) H1659C1063N289O294S4
Molecular weight (pH 7.5; Da) 23319.50 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
35995
Instability index 26.70
Is stable True
Aliphatic index 89.04
GRAVY (25C, pH 7.0) -0.622
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization e View in model
 
Metadata
Created 2012-10-01 15:07:56
Last updated 2012-10-01 15:14:39