MG_285_MONOMER

Name
WID MG_285_MONOMER View in model
 
Genetics
Gene MG_285 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MAAILNVQRIQNNQVTEYTMSPVRNFANTKDVYFDAQLTNIESKIDSSRA
QIHLTIALKYNTNLPDNIFQAHFSLGNWQSDKIQLQKAPDKKHDSLNSIK
YFYAFLDVPRSALAKKEINRFSNVVARVLRISFRLQDQSEKGNWSDYHLF
DTVASELYATVIKETINFGNMIKINALDGSKQLTSSQGSFKYSWTMYDYR
NLEQLDEVRNLINISFDKPVQIVNVDVKIHYVPTKGRLQEIKQQGEFENN
LDVNEKLKLNLIGNWNFDKHNKKLISDISGTGIFLPQGGYGSYEIMIGAT
VGNDFYTIIANNQFKYETPLDDLEQNDFFEVNYLPVYSTYNFSDLTQ*
50
100
150
200
250
300
348
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2771C1807N477O545S5
Molecular weight (pH 7.5; Da) 40057.42 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
48820
Instability index 34.66
Is stable True
Aliphatic index 86.55
GRAVY (25C, pH 7.0) -0.466
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Metadata
Created 2012-10-01 15:07:56
Last updated 2012-10-01 15:14:39