MG_283_MONOMER – prolyl-tRNA synthetase

Name
WID MG_283_MONOMER View in model
Name prolyl-tRNA synthetase View in model
 
Genetics
Gene MG_283 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
MTKKTQDLTSWYDQLLVKAKLICHGEVKGTVCFLNNSWGLWMEIQQLYND
AIANKNQLSAIALTKFQPTTSFCYQVFQVQLPTLSFYSEYQKEKTHIKGF
NPELFLINQVGQKQLNDPLVLRPTSEIAFCNLWKKQELSYHDLPLIYNQW
TQVFRAEKNTRPFLRNSEFYWQETHGLFVDQSQSEQAAISFWNLYQDLII
NKLCIPAFVGLKSESEKFAGAKNTWTIEAIMPDGQSLQCATSHDLGDTFT
KSFTISYQSKTNQKMTPSSFSCGMSTRILGAIFLTHSDDYGLVLPWYLAS
KQVKLYLFDKNNNPKTRALAFLVKDFLEKLKIRFSFIEINNQLGKQLLKG
EIEGIPLQMIVDNEKTINIFNRLTRLKTSLTFANLQTEFVNLVNNYHTEM
YRKANDLVEQKLARVQTLKEIEQAFKNKKAVLCTVKLTGELEQHLKTKYQ
VSVRCVFKKSDVTQNCPFTNQPCFDSVLIARAY*
50
100
150
200
250
300
350
400
450
484
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3961C2540N659O724S18
Molecular weight (pH 7.5; Da) 55890.62 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
76205
Instability index 37.24
Is stable True
Aliphatic index 87.02
GRAVY (25C, pH 7.0) -0.301
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER View in model
 
Function
Complex subunit prolyl-tRNA synthetase
[c]: (2) MG_283_MONOMERMG_283_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer.
 
Metadata
Created 2012-10-01 15:07:56
Last updated 2012-10-01 15:14:39