MG_282_MONOMER – transcription elongation factor GreA

Name
WID MG_282_MONOMER View in model
Name transcription elongation factor GreA View in model
Cross references PDB: 1GRJ
 
Genetics
Gene MG_282 View in model
 
Structure
Sequence
1
51
101
151
MELNKNYLTQEGFKQLEKELENLIQVKRPEIIRLLQEARDQGDLSENADY
DAAKAQQGEIETRIAEIQDILANAKLISDHQAKTKVTKVSLGSTVEIYDY
SSKSNEKYTIVGTLEANPEEHKISNESPLALAIYGRLIGDECDVVGIEVP
YRVKILKISNR*
50
100
150
162
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1293C798N218O260S2
Molecular weight (pH 7.5; Da) 18165.19 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
10555
Instability index 42.49
Is stable False
Aliphatic index 100.56
GRAVY (25C, pH 7.0) -0.529
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_392_393_21MER View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0380, PUB_0381]. Stable modifications Phosphorylation observed by mass-spec [PUB_0094].
References
  1. Stebbins CE, Borukhov S, Orlova M, Polyakov A, Goldfarb A, Darst SA. Crystal structure of the GreA transcript cleavage factor from Escherichia coli. Nature 373, 636-40 (1995). WholeCell: PUB_0380, PubMed: 7854424

  2. Su HC, Hutchison CA 3rd, Giddings MC. Mapping phosphoproteins in Mycoplasma genitalium and Mycoplasma pneumoniae. BMC Microbiol 7, 63 (2007). WholeCell: PUB_0094, PubMed: 17605819

  3. Vassylyeva MN, Svetlov V, Dearborn AD, Klyuyev S, Artsimovitch I, Vassylyev DG. The carboxy-terminal coiled-coil of the RNA polymerase beta'-subunit is the main binding site for Gre factors. EMBO Rep 8, 1038-43 (2007). WholeCell: PUB_0381, PubMed: 17917675

 
Metadata
Created 2012-10-01 15:07:56
Last updated 2012-10-01 15:14:39