MG_280_MONOMER – sensory rhodopsin II transducer motif

Name
WID MG_280_MONOMER View in model
Name sensory rhodopsin II transducer motif View in model
 
Genetics
Gene MG_280 View in model
 
Structure
Sequence
1
51
101
151
201
251
MVIFINRFSKTILLFFGMLVFVFLLGFGITALYFRSTAANLYVQARNSID
SSFNSAKAFANALANSANQFSKSSITNNLDQVKKDLEQSLQKVDEYKKNL
ESQNNLGNISQEKIRELDATKKDLENSKTQLDNFKNNLDKNGTASSSPSV
KKQATADGVISAVSEFSTQAQSIVSSYEKIKNNIPSSEQFNNYYDVTMIT
IVAVSGGMLAILITTIVFSFLTSKKRGLIRFSRFISTEQLADHVNDILDR
YPDLEEEVITALDHD*
50
100
150
200
250
266
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H2088C1318N349O414S4
Molecular weight (pH 7.5; Da) 29574.95 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
10430
Instability index 34.26
Is stable True
Aliphatic index 92.41
GRAVY (25C, pH 7.0) -0.191
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:07:56
Last updated 2012-10-01 15:14:39