MG_279_MONOMER

Name
WID MG_279_MONOMER View in model
 
Genetics
Gene MG_279 View in model
 
Structure
Sequence
1
51
101
151
201
MIRLLKKLAVFLIILVGILLLGGIATAGYFAFTYREPINNYYKEGYNKIS
EYNTEIKKISQNIFQNNLVKTLSEVEKSLNEGRKLTQNNSFASGLDSSLN
ALEGSLKKINNFDSNAAFTQIKHTLNNITSFVDQMLEKFPNPNQNDDFKR
YLTEVSQILFYTGISIIGAFFVSGFLLILFTKKVYGVRVSRFNPQRLLKK
HLVLLLRDEEVYDAVFGN*
50
100
150
200
219
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H1806C1146N293O322S2
Molecular weight (pH 7.5; Da) 24904.43 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
14900
Instability index 24.05
Is stable True
Aliphatic index 105.48
GRAVY (25C, pH 7.0) -0.0443
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Metadata
Created 2012-10-01 15:07:56
Last updated 2012-10-01 15:14:39