MG_277_MONOMER – Protein-export membrane protein secDF

Name
WID MG_277_MONOMER View in model
Name Protein-export membrane protein secDF View in model
 
Genetics
Gene MG_277 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
501
551
601
651
701
751
801
851
901
951
VRFKKRFSLDWILKIGTILGLVCLGLFGVIFGSYKLLNDSRLGAVFNGST
TTTVYFLNHKSTNNTSLDPQQTKPTNGIENITNIDSFLDGVEKSYANSLF
IQGFSSVNITKNTNDKTASELDNIDKSWLVNGGLPSVTLTFEQNREQAKT
RQRKRQVDAQVRRNAISSVEHNYQLSLETTDGVVLFDSLDNNFINASIRA
VVPQNTSVNSALTFEYKLNKNVVTKESLHTDFLDFINSKNLSSSDYNTGN
GQASVEGNGKFFKQNANGTSSSGNKTLVLWKDKQGALNYVRNIFNVVEGS
SDYLTFNEREKSLWEFLHAKGSFASGDNLFLNTDANGASPIKKASDITLK
NLYYIYAAPNHFSAVASNSNDNNNQNNNNNNNSSDVITVSNSADTRKLRS
ADSSGFSGLFHNYIISEIRTEDPVSKTGDPVKINPTLQSFLDTNNQRIEY
GGNIKFQVGNFLSSDGTYTPPNFVTAATVKELLTNPFPTAATIATAKTSL
VNAPLANTITDVSNFASSFIAFGIIVLIAAVLLTLRYKLLGLYKALALGL
SVVSSLVIFSAVGGVVDVFSFVGIFFVIAINLINLLNLGELFLRNIRNNA
SIIESWKLCLKRSFFANLEFHITWLISALVVIYLSNYQVQQLANLMAISA
ITSYFFSYGISIVLISLFVSSESGANWKLFLYQKDAKALTKTSSNYSLLS
STSDLNTDFFITKNQHDFFLKNNWKFLFVWLILLAIGVVMLVLYLVQPNL
LGEFLAADVESSNGIIAGIGIVSLLYLAYCLIRYGVAYCLSYLVSFILLC
SGLFAVMYLTNYLFSIDQSTIQLITFVYLFWLFFAAKVSQTTTWTYFYWF
KRSLKDKVFIKNLFNDNFNSQWKIDLIESSSLVFIFIIYSGFNFGGIDGN
FNLVIFYLIAIVGLFDVATAFLPMFCFGLINGWLSPFNYVHSRLSLKHKK
HPFKEIDQIEEQLIAGINSF*
50
100
150
200
250
300
350
400
450
500
550
600
650
700
750
800
850
900
950
971
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H7648C4973N1250O1430S10
Molecular weight (pH 7.5; Da) 108145.80 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
131390
Instability index 28.53
Is stable True
Aliphatic index 102.90
GRAVY (25C, pH 7.0) 0.165
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit preprotein translocase
[m]: (4) MG_055_MONOMER + (4) MG_170_MONOMER + (4) MG_277_MONOMER + (4) MG_464_MONOMER + (4) MG_476_MONOMERMG_055_170_277_464_476_20MER
View in model
 
Comments
Comments Functional Macromolecule Functional as monomer [PUB_0328].
References
  1. Duong F, Wickner W. Distinct catalytic roles of the SecYE, SecG and SecDFyajC subunits of preprotein translocase holoenzyme. EMBO J 16, 2756-68 (1997). WholeCell: PUB_0328, PubMed: 9184221

 
Metadata
Created 2012-10-01 15:07:56
Last updated 2012-10-01 15:14:39