MG_276_MONOMER – adenine phosphoribosyltransferase

Name
WID MG_276_MONOMER View in model
Name adenine phosphoribosyltransferase View in model
Cross references PDB: 2DY0
 
Genetics
Gene MG_276 View in model
 
Structure
Sequence
1
51
101
151
MDQNFKLLDQAIKRFENFPNQGTLFYDITPVFSNPQLFNFVLTQMAQFIK
AINAEAIVCPEARGFIFGGALASKTQLPLVLVRKANKLPGQLISASYDLE
YRKHAVLEMSTTSLIQANNAKRCVIVDDVLATAGTVAAIDQLLKQLNGET
VGYCFLIELKKLNGKAKLQPNVVSKILLHY*
50
100
150
181
View in model
Is N‑terminal methionine cleaved
No
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H1462C911N237O254S6
Molecular weight (pH 7.5; Da) 19991.12 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
7825
Instability index 22.60
Is stable True
Aliphatic index 108.34
GRAVY (25C, pH 7.0) 0.146
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit adenine phosphoribosyltransferase
[c]: (2) MG_276_MONOMERMG_276_DIMER
View in model
 
Comments
Comments Functional Macromolecule Functional as homodimer. Coenzymes Monomer interacts with MG with unknown stoichiometry as prosthetic group.
 
Metadata
Created 2012-10-01 15:07:56
Last updated 2012-10-01 15:14:39