MG_275_MONOMER – NADH oxidase

Name
WID MG_275_MONOMER View in model
Name NADH oxidase View in model
 
Genetics
Gene MG_275 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
401
451
MKKVIVIGINHAGTSFIRTLLSKSKDFKVNAYDRNTNISFLGCGIALAVS
GVVKNTDDLFYSNPEELKQMGANIFMSHDVTNIDLIKKQVTVRDLTSNKE
FTDQFDQLVIASGAWPICMNVENKVTHKPLEFNYTDKYCGNVKNLISCKL
YQHALTLIDSFRKDKTIKSVAIVGSGYIGLELAEAAWLCKKQVTVIDLLD
KPAGNNFDHEFTDELEKVMQKDGLKLMMGCSVKGFVVDSTNNVVKGVETD
KGIVNADLVIQSIGFRPSTKFVPKDQNFEFIHNGSIKVNEFLQALNHKDV
YVIGGCAAIYNAASEQYENIDLATNAVKSGLVAAMHIIGSNQVKLQSIVG
TNALHIFGLNLAACGLTEQRAKKLGFDVGISVVDDNDRPEFMGSYDKVRF
KLVYDKKTLRILGAQLLSWNTNHSEIIFYIALAIQKQMLLTELGLVDVYF
LPHYNKPFNFVLATVLQALGFSYYIPKK*
50
100
150
200
250
300
350
400
450
479
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3802C2405N625O696S18
Molecular weight (pH 7.5; Da) 53184.71 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
41340
Instability index 26.08
Is stable True
Aliphatic index 100.29
GRAVY (25C, pH 7.0) 0.00626
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization m View in model
 
Function
Complex subunit NADH oxidase
[m]: (4) MG_275_MONOMERMG_275_TETRAMER
View in model
 
Comments
Comments Functional Macromolecule Homologous to Streptococcus faecalis npr which is active as homotetramer [PUB_0429]. Coenzymes Interacts with 1 FAD per monomer as coenzyme [96].
References
  1. Ross RP, Claiborne A. Cloning, sequence and overexpression of NADH peroxidase from Streptococcus faecalis 10C1. Structural relationship with the flavoprotein disulfide reductases. J Mol Biol 221, 857-71 (1991). WholeCell: PUB_0429, PubMed: 1719212

 
Metadata
Created 2012-10-01 15:07:56
Last updated 2012-10-01 15:14:39