MG_274_MONOMER – pyruvate dehydrogenase component E1, alpha subunit

Name
WID MG_274_MONOMER View in model
Name pyruvate dehydrogenase component E1, alpha subunit View in model
 
Genetics
Gene MG_274 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MAILIKNKVPTTLYQVYDNEGKLIDPNHKITLTDEQLKHAYYLMNLSRMM
DKKMLVWQRAGKMLNFAPNLGEEALQVGMGLGLNENDWVCPTFRSGALML
YRGVKPEQLLLYWNGNEKGSQIDAKYKTLPINITIGAQYSHAAGLGYMLH
YKKQPNVAVTMIGDGGTAEGEFYEAMNIASIHKWNTVFCINNNQFAISTR
TKLESAVSDLSVKAIACGIPRVRVDGNDLIASYEAMQDAANYARGGNGPV
LIEFFSYRQGPHTTSDDPSIYRTKQEEEEGMKSDPVKRLRNFLFDRSILN
QAQEEEMFSKIEQEIQAAYEKMVLDTPVSVDEVFDYNYQELTPELVEQKQ
IAKKYFKD*
50
100
150
200
250
300
350
359
View in model
Is N‑terminal methionine cleaved
Yes
View in model
Empirical formula (pH 7.5) H2818C1812N481O546S18
Molecular weight (pH 7.5; Da) 40653.72 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
50685
Instability index 40.90
Is stable False
Aliphatic index 81.25
GRAVY (25C, pH 7.0) -0.429
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
 
Function
Complex subunit pyruvate dehydrogenase
[c]: (12) MG_271_MONOMER + (60) MG_272_MONOMER + (60) MG_273_MONOMER + (60) MG_274_MONOMERMG_271_272_273_274_192MER
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_271_272_273_274_192MER). Stable modifications Phosphorylation observed by mass-spec [PUB_0094]. N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

  2. Su HC, Hutchison CA 3rd, Giddings MC. Mapping phosphoproteins in Mycoplasma genitalium and Mycoplasma pneumoniae. BMC Microbiol 7, 63 (2007). WholeCell: PUB_0094, PubMed: 17605819

 
Metadata
Created 2012-10-01 15:07:55
Last updated 2012-10-01 15:14:39