MG_273_MONOMER – pyruvate dehydrogenase component E1, beta subunit

Name
WID MG_273_MONOMER View in model
Name pyruvate dehydrogenase component E1, beta subunit View in model
 
Genetics
Gene MG_273 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
MSKIQVNNIEALNNAMDLALERDQNVVLYGQDAGFEGGVFRATKGLQQKY
GSERVWDCPIAENSMAGIGVGAAIGGLKPIVEIQFSGFSFPAMFQIFVHA
ARIRNRSRGVYTAPLVVRMPMGGGIKALEHHSETLEAIYAQIAGLKTVMP
SNPYDTKGLFLAAIESPDPVIFFEPKKLYRAFRQEIPSDYYTVPIGEANL
ISEGSELTIVSYGPTMFDLINLVYSGELKDKGIELIDLRTISPWDKQTVF
NSVKKTGRLLVVTEAVKSFTTSAEIITSVTEELFTYLKKAPQRVTGFDIV
VPLARGEKYQFEINARVIDAVNQLLK*
50
100
150
200
250
300
327
View in model
Is N‑terminal methionine cleaved
Yes
View in model
Prosthetic groups View in model
Empirical formula (pH 7.5) H2576C1634N424O474S9
Molecular weight (pH 7.5; Da) 36032.98 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
29005
Instability index 35.04
Is stable True
Aliphatic index 96.61
GRAVY (25C, pH 7.0) 0.00612
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER, MG_392_393_21MER View in model
 
Function
Complex subunit pyruvate dehydrogenase
[c]: (12) MG_271_MONOMER + (60) MG_272_MONOMER + (60) MG_273_MONOMER + (60) MG_274_MONOMERMG_271_272_273_274_192MER
View in model
 
Comments
Comments Functional Macromolecule Functional as hetercomplex (see MG_271_272_273_274_192MER). Coenzymes Interacts with 1 TPP per monomer as coenzyme [96,171,387]. Stable modifications Phosphorylation observed by mass-spec [PUB_0094]. N-terminal methionine cleavage Shewanella oneidensis MR-1 homolog undergoes N-terminal methionine cleavage [PUB_0280].
References
  1. Gupta N, Tanner S, Jaitly N, Adkins JN, Lipton M, Edwards R, Romine M, Osterman A, Bafna V, Smith RD, Pevzner PA. Whole proteome analysis of post-translational modifications: applications of mass-spectrometry for proteogenomic annotation. Genome Res 17, 1362-77 (2007). WholeCell: PUB_0280, PubMed: 17690205

  2. Su HC, Hutchison CA 3rd, Giddings MC. Mapping phosphoproteins in Mycoplasma genitalium and Mycoplasma pneumoniae. BMC Microbiol 7, 63 (2007). WholeCell: PUB_0094, PubMed: 17605819

 
Metadata
Created 2012-10-01 15:07:55
Last updated 2012-10-01 15:14:39