MG_272_MONOMER – dihydrolipoamide acetyltransferase

Name
WID MG_272_MONOMER View in model
Name dihydrolipoamide acetyltransferase View in model
Cross references PDB: 1QJO
 
Genetics
Gene MG_272 View in model
 
Structure
Sequence
1
51
101
151
201
251
301
351
MANEFKFTDVGEGLHEGKVTEILKQVGDQIKIDEALFVVETDKVTTELPS
PFAGTISAINVKVGDVVSIGQVMAVIGEKTSTPLVEPKPQPTEEVAKVKE
AGASVVGEIKVSDNLFPIFGVKPHATPAVKDTKVASSTNITVETTQKPES
KTEQKTIAISTMRKAIAEAMTKSHAIIPTTVLTFYVNATKLKQYRESVNG
YALSKYSMKISYFAFFVKAIVNALKKFPVFNASYDPDQNEIVLNDDINVG
IAVDTEEGLIVPNIKQAQTKSVVEIAQAIVDLANKARTKKIKLTDLNKGT
ISVTNFGSLGAAVGTPIIKYPEMCIVATGNLEERIVKVENGIAVHTILPL
TIAADHRWVDGADVGRFGKEIAKQIEELIDLTVA*
50
100
150
200
250
300
350
385
View in model
Is N‑terminal methionine cleaved
No
View in model
Empirical formula (pH 7.5) H3025C1864N479O568S7
Molecular weight (pH 7.5; Da) 41458.17 View in model
Extinction coefficient 
(260 nm, 25C, pH 7.0)
16055
Instability index 21.56
Is stable True
Aliphatic index 100.49
GRAVY (25C, pH 7.0) 0.0197
Half life (OD (600 nm) = 0.3, 
M9 media, 36C; min)
1200 View in model
 
Synthesis
Localization c View in model
Chaperones MG_305_MONOMER, MG_392_393_21MER View in model
 
Function
Complex subunit pyruvate dehydrogenase
[c]: (12) MG_271_MONOMER + (60) MG_272_MONOMER + (60) MG_273_MONOMER + (60) MG_274_MONOMERMG_271_272_273_274_192MER
View in model
 
Comments
Comments contains a lipoyl domain similar to other bacterial species, and unlike M. hyopneumoniae [PUB_0818]. Functional as hetercomplex (see MG_271_272_273_274_192MER). Undergoes lipoate ligation [PUB_0288].
References
  1. Matic JN, Wilton JL, Towers RJ, Scarman AL, Minion FC, Walker MJ, Djordjevic SP. The pyruvate dehydrogenase complex of Mycoplasma hyopneumoniae contains a novel lipoyl domain arrangement. Gene 319, 99-106 (2003). WholeCell: PUB_0818, PubMed: 14597175

  2. Stephens PE, Darlison MG, Lewis HM, Guest JR. The pyruvate dehydrogenase complex of Escherichia coli K12. Nucleotide sequence encoding the dihydrolipoamide acetyltransferase component. Eur J Biochem 133, 481-9 (1983). WholeCell: PUB_0288, PubMed: 6345153

 
Metadata
Created 2012-10-01 15:07:55
Last updated 2012-10-01 15:14:39